Result : EXP01132
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01132 |
| NCBI Accession ID | ABAX03000039.1 |
| Organism | Anaerostipes caccae (strain DSM 14662 / NCIMB 13811 / L1-92) |
| Left | 3829 |
| Right | 4008 |
| Strand | - |
| Nucleotide Sequence | ATGGGACTTTTAACAAGAGTAACAGATAATAATCCATTTAGTAAAGATATCGACGAATTGCTGGAAAAGCGTGCTGATGTACAGGAAAAAGATACGGAAGACGGACTTACCTATGAAGAATCTATGAAAAAGATTGAGGAACGGATTAAGGAATTAGGCATCCTTGAAGAGGAAGAATAA |
| Sequence | MGLLTRVTDNNPFSKDIDELLEKRADVQEKDTEDGLTYEESMKKIEERIKELGILEEEE |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 31841667 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 59 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1246097 | 1246276 | + | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 2 | 2406796 | 2406978 | - | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP036345.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02823.18 | 1.0 | 2 | 6501.5 | same-strand | ATP synthase, Delta/Epsilon chain, beta-sandwich domain |
| 2 | PF00401.22 | 1.0 | 2 | 6501.5 | same-strand | ATP synthase, Delta/Epsilon chain, long alpha-helix domain |
| 3 | PF00122.22 | 1.0 | 2 | 3468.0 | same-strand | E1-E2 ATPase |
| 4 | PF00689.23 | 1.0 | 2 | 3468.0 | same-strand | Cation transporting ATPase, C-terminus |
| 5 | PF00702.28 | 1.0 | 2 | 3468.0 | same-strand | haloacid dehalogenase-like hydrolase |
| 6 | PF13246.8 | 1.0 | 2 | 3468.0 | same-strand | Cation transport ATPase (P-type) |
| 7 | PF00690.28 | 1.0 | 2 | 3468.0 | same-strand | Cation transporter/ATPase, N-terminus |
| 8 | PF00497.22 | 1.0 | 2 | 871.0 | same-strand | Bacterial extracellular solute-binding proteins, family 3 |
| 9 | PF00072.26 | 1.0 | 2 | 564.5 | same-strand | Response regulator receiver domain |
| 10 | PF00512.27 | 1.0 | 2 | 871.0 | same-strand | His Kinase A (phospho-acceptor) domain |
| 11 | PF04055.23 | 1.0 | 2 | 238.0 | same-strand | Radical SAM superfamily |
| 12 | PF06968.15 | 1.0 | 2 | 238.0 | same-strand | Biotin and Thiamin Synthesis associated domain |
| 13 | PF02632.16 | 1.0 | 2 | 1213.0 | same-strand | BioY family |
| 14 | PF12822.9 | 1.0 | 2 | 1213.0 | same-strand | ECF transporter, substrate-specific component |
| 15 | PF00005.29 | 1.0 | 2 | 1955.0 | same-strand | ABC transporter |
| 16 | PF12730.9 | 1.0 | 2 | 2863.0 | same-strand | ABC-2 family transporter protein |
| 17 | PF00132.26 | 1.0 | 2 | 4049.5 | same-strand | Bacterial transferase hexapeptide (six repeats) |
| 18 | PF14602.8 | 1.0 | 2 | 4049.5 | same-strand | Hexapeptide repeat of succinyl-transferase |
++ More..