Result : EXP01130
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01130 |
| NCBI Accession ID | AE015928.1 |
| Organism | Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) |
| Left | 975200 |
| Right | 975373 |
| Strand | - |
| Nucleotide Sequence | ATGAGCAGACGTAGTCAATTAGAGCATGAAGTATCTGTTGCTCAGGAAAGAATTAAGAAGGCAGCCAAAGATACACCGAAAGATATCATAAAGTTATGGGAACAAGACTTGGTAGACTTGGAACTTGAACTCAATAACCTGGTAGATGATGAAGAAGATAATAATGAAGATTAA |
| Sequence | MSRRSQLEHEVSVAQERIKKAAKDTPKDIIKLWEQDLVDLELELNNLVDDEEDNNED |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 31841667 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 57 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4553295 | 4553468 | - | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 2 | 2665895 | 2666065 | - | NZ_LN877293.1 | Bacteroides fragilis |
| 3 | 1039556 | 1039729 | + | NZ_CP012938.1 | Bacteroides ovatus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP040530.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00076.24 | 0.67 | 2 | 913.0 | opposite-strand | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) |
| 2 | PF14342.8 | 0.67 | 2 | 138.0 | opposite-strand | Domain of unknown function (DUF4396) |
| 3 | PF02629.21 | 1.0 | 3 | 964 | same-strand | CoA binding domain |
| 4 | PF00549.21 | 1.0 | 3 | 995.5 | same-strand | CoA-ligase |
| 5 | PF08442.12 | 1.0 | 3 | 1854 | same-strand | ATP-grasp domain |
| 6 | PF00698.23 | 1.0 | 3 | 3184 | same-strand | Acyl transferase domain |
| 7 | PF08543.14 | 1.0 | 3 | 4122 | same-strand | Phosphomethylpyrimidine kinase |
++ More..