Result : EXP01125
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01125 |
| NCBI Accession ID | NC_016810.1 |
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 |
| Left | 2759058 |
| Right | 2759246 |
| Strand | - |
| Nucleotide Sequence | ATGAAAGAAGGCTTCTACTGGATACAGCACAACGGCAGGGTTCAGGTTGCTTACTACACCCACGGCGTAACCGAGGACCTGGAAACTGGTCAGACTATTATTGGTGTCTGGCATCTGACGCAGGGCGATGACATTTGTCACAACGGAGAGGCTGAGATTCTGGCGGGACCGTTAGAACCTCCAATTTAA |
| Sequence | MKEGFYWIQHNGRVQVAYYTHGVTEDLETGQTIIGVWHLTQGDDICHNGEAEILAGPLEPPI |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | Venturini et al 2020 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 62 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2761372 | 2761560 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 2591635 | 2591826 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 3 | 2505193 | 2505384 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 4 | 4780316 | 4780507 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 5 | 2592659 | 2592850 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 6 | 608370 | 608558 | - | NZ_CP033744.1 | Citrobacter freundii |
| 7 | 292597 | 292785 | - | NZ_CP033744.1 | Citrobacter freundii |
| 8 | 1553749 | 1553937 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 9 | 3373022 | 3373216 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 10 | 2447817 | 2448008 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 11 | 2576054 | 2576245 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 12 | 1676083 | 1676277 | + | NZ_CP011602.1 | Phytobacter ursingii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003197.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00959.21 | 0.7 | 7 | 682.0 | same-strand | Phage lysozyme |
++ More..