Protein Information |
Information Type | Description |
---|---|
Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
NCBI Accession ID | CP001037.1 |
Organism | Nostoc punctiforme (strain ATCC 29133 / PCC 73102) |
Left | 3598812 |
Right | 3599039 |
Strand | - |
Nucleotide Sequence | ATGGTTAAACGTAAAGGTGCTTCTAGTTCTGAGGAAGGTTGGAATTATGAGGCGAAGGTTGCTGAAATAGAGGGAATTATTACTCGCATTGAGGCGGGTGAGTTGGAATTGGAAGCGGTGTTTGAGCAATTTGCCAGTGCTGTTGAGTATTTGCGTCAGTGTGAAAGTTTTTTGCAGCAGCGACAGCAGCAGGTGGATTTGTTGATTGAAACATTAAGCGAAGAGTAG |
Sequence | MVKRKGASSSEEGWNYEAKVAEIEGIITRIEAGELELEAVFEQFASAVEYLRQCESFLQQRQQQVDLLIETLSEE |
Source of smORF | Swiss-Prot |
Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
Pubmed ID | |
Domain | CDD:412547 |
Functional Category | Others |
Uniprot ID | B2IWI8 |
ORF Length (Amino Acid) | 75 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3598812 | 3599039 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
2 | 2139996 | 2140223 | - | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
3 | 6253750 | 6253977 | + | NZ_CP031941.1 | Nostoc sphaeroides |
4 | 3862288 | 3862515 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
5 | 2614164 | 2614424 | - | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
6 | 1927102 | 1927350 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
7 | 2375810 | 2376031 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
8 | 1957347 | 1957613 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
9 | 3267114 | 3267341 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
10 | 95182 | 95415 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
11 | 3147527 | 3147739 | - | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
12 | 294838 | 295065 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13742.8 | 0.92 | 11 | 12 | same-strand | OB-fold nucleic acid binding domain |
2 | PF01336.27 | 0.92 | 11 | 12 | same-strand | OB-fold nucleic acid binding domain |