Result : EXP01124
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01124 |
| NCBI Accession ID | NC_016810.1 |
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 |
| Left | 1866965 |
| Right | 1867063 |
| Strand | - |
| Nucleotide Sequence | ATGAATAACCAACCGTTGCGCGTTTCAAAGGATCAGCCCAGGAAGCCTGATAAGACACCCGAAGACGAAGGAAAAAATCCAAAGAAAAACCAAAAGTAG |
| Sequence | MNNQPLRVSKDQPRKPDKTPEDEGKNPKKNQK |
| Source of smORF | Protein-level |
| Function | The protein encoded by this ORF is under the control of the RNA Polymerase sigma factor RpoS which plays a role in general stress response. It is abundantly expressed in the stationary phase. Pubmed:28522802 |
| Pubmed ID | Venturini et al 2020 |
| Domain | |
| Functional Category | Manually curated function from literature |
| Uniprot ID | |
| ORF Length (Amino Acid) | 32 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1910106 | 1910204 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 4420891 | 4420989 | - | NZ_CP053416.1 | Salmonella bongori |
| 3 | 2048473 | 2048556 | - | NZ_AP023184.1 | Buttiauxella agrestis |
| 4 | 2519213 | 2519311 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
++ More..