Protein name |
EXP01124 |
NCBI Accession ID |
NC_016810.1 |
Organism |
Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 |
Left |
1866965 |
Right |
1867063 |
Strand |
- |
Nucleotide Sequence |
ATGAATAACCAACCGTTGCGCGTTTCAAAGGATCAGCCCAGGAAGCCTGATAAGACACCCGAAGACGAAGGAAAAAATCCAAAGAAAAACCAAAAGTAG |
Sequence |
MNNQPLRVSKDQPRKPDKTPEDEGKNPKKNQK |
Source of smORF |
Protein-level |
Function |
The protein encoded by this ORF is under the control of the RNA Polymerase sigma factor RpoS which plays a role in general stress response. It is abundantly expressed in the stationary phase. Pubmed:28522802 |
Pubmed ID |
Venturini et al 2020
|
Domain |
|
Functional Category |
Manually curated function from literature |
Uniprot ID |
|
ORF Length (Amino Acid) |
32 |