Result : EXP01116
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01116 |
| NCBI Accession ID | NC_016810.1 |
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 |
| Left | 4629376 |
| Right | 4629573 |
| Strand | + |
| Nucleotide Sequence | ATGAATTCAACAATCTGGTTGGCGCTTGCTCTGGTATTAGTCCTCGAAGGGCTGGGACCGATGCTGTATCCCGGCGCATGGAAAAAAATGGTTTCGGCACTGGCGCAACTGCCGGAAAATGTTTTACGTCGTTTTGGCGGCGGACTTGTGGTCGCGGGAGTTGTGGTCTACTACATGTTGAGGAAAACGATTGGCTGA |
| Sequence | MNSTIWLALALVLVLEGLGPMLYPGAWKKMVSALAQLPENVLRRFGGGLVVAGVVVYYMLRKTIG |
| Source of smORF | Protein-level |
| Function | integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] The ORF matches to the profile of cl01275. Profile Description: Uncharacterized protein conserved in bacteria (DUF2065). This domain, found in various prokaryotic proteins, has no known function. |
| Pubmed ID | Venturini et al 2020 |
| Domain | CDD:412824 |
| Functional Category | Gene Ontology/Expression based functional assignment |
| Uniprot ID | P0AF75 |
| ORF Length (Amino Acid) | 65 |
++ More..
| Conservation Analysis |
No. of Species: 162
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4608811 | 4609008 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 2387935 | 2388132 | + | NZ_CP053416.1 | Salmonella bongori |
| 3 | 5410200 | 5410397 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 4 | 4099197 | 4099394 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 5 | 4023125 | 4023322 | - | NZ_AP023184.1 | Buttiauxella agrestis |
| 6 | 591962 | 592159 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 7 | 3417707 | 3417904 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 8 | 447542 | 447739 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 9 | 2136957 | 2137157 | + | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 10 | 420551 | 420751 | + | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 11 | 3643767 | 3643955 | - | NZ_CP015581.1 | Tatumella citrea |
| 12 | 3516989 | 3517186 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 13 | 433915 | 434112 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 14 | 1311590 | 1311790 | - | NZ_CP023706.1 | Edwardsiella tarda |
| 15 | 3339400 | 3339600 | - | NZ_CP016043.1 | Edwardsiella hoshinae |
| 16 | 4204469 | 4204666 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 17 | 5036318 | 5036518 | + | NZ_CP014137.1 | Brenneria goodwinii |
| 18 | 2965959 | 2966156 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 19 | 421090 | 421287 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 20 | 432233 | 432430 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 21 | 444661 | 444858 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 22 | 426613 | 426810 | + | NC_015968.1 | Enterobacter soli |
| 23 | 2164588 | 2164785 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 24 | 2062467 | 2062667 | - | NZ_CP014136.1 | Gibbsiella quercinecans |
| 25 | 1040079 | 1040279 | - | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
| 26 | 459245 | 459442 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 27 | 514749 | 514949 | + | NZ_CP050150.1 | Hafnia alvei |
| 28 | 5043921 | 5044118 | - | NZ_CP054254.1 | Klebsiella variicola |
| 29 | 4762780 | 4762977 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 30 | 639694 | 639894 | + | NZ_CP034036.1 | Brenneria nigrifluens DSM 30175 = ATCC 13028 |
| 31 | 5525318 | 5525515 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 32 | 5530527 | 5530724 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 33 | 536707 | 536904 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 34 | 3258005 | 3258205 | - | NZ_CP034035.1 | Brenneria rubrifaciens |
| 35 | 1427997 | 1428197 | - | NZ_CP015137.1 | Dickeya solani IPO 2222 |
| 36 | 4732431 | 4732628 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 37 | 4079710 | 4079910 | - | NZ_CP025799.1 | Dickeya zeae |
| 38 | 3480241 | 3480441 | + | NZ_CP009460.1 | Dickeya fangzhongdai |
| 39 | 3096761 | 3096958 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 40 | 562976 | 563176 | + | NC_012912.1 | Dickeya chrysanthemi Ech1591 |
| 41 | 4249835 | 4250035 | - | NC_014500.1 | Dickeya dadantii 3937 |
| 42 | 3900419 | 3900616 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 43 | 2117362 | 2117562 | + | NZ_CP019706.1 | Pantoea alhagi |
| 44 | 4257253 | 4257453 | - | NZ_CP031560.1 | Dickeya dianthicola |
| 45 | 3749775 | 3749975 | - | NZ_CP061511.1 | Mixta calida |
| 46 | 4207851 | 4208048 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 47 | 5133706 | 5133903 | - | NZ_CP050508.1 | Raoultella terrigena |
| 48 | 1221575 | 1221772 | - | NZ_CP042941.1 | Atlantibacter hermannii |
| 49 | 3972455 | 3972655 | - | NZ_CP026377.1 | Mixta gaviniae |
| 50 | 3119021 | 3119221 | - | NZ_CP028271.1 | Mixta intestinalis |
| 51 | 544689 | 544889 | + | NC_014306.1 | Erwinia billingiae Eb661 |
| 52 | 3693335 | 3693532 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 53 | 571655 | 571855 | + | NZ_CP042220.2 | Dickeya poaceiphila |
| 54 | 2671248 | 2671445 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 55 | 4894939 | 4895136 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 56 | 185412 | 185609 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 57 | 1720302 | 1720499 | + | NZ_CP040428.1 | Jejubacter calystegiae |
| 58 | 645063 | 645263 | - | NZ_CP023009.1 | Lonsdalea britannica |
| 59 | 3944922 | 3945122 | - | NZ_LT615367.1 | Dickeya aquatica |
| 60 | 2205601 | 2205798 | + | NZ_CP026047.1 | Raoultella planticola |
| 61 | 4820320 | 4820517 | - | NZ_CP041247.1 | Raoultella electrica |
| 62 | 5112562 | 5112759 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 63 | 4113096 | 4113296 | + | NZ_CP067057.1 | Rahnella aceris |
| 64 | 392540 | 392740 | + | NZ_CP065534.1 | Lonsdalea populi |
| 65 | 4103306 | 4103503 | - | NZ_LR134201.1 | Cedecea lapagei |
| 66 | 4394697 | 4394894 | - | NZ_CP023525.1 | Cedecea neteri |
| 67 | 2601755 | 2601955 | + | NZ_CP011078.1 | Yersinia ruckeri |
| 68 | 3399372 | 3399569 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 69 | 3802670 | 3802867 | - | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 70 | 1073633 | 1073830 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 71 | 2324532 | 2324732 | + | NZ_CP011254.1 | Serratia fonticola |
| 72 | 540923 | 541123 | + | NZ_CP045720.1 | Pantoea eucalypti |
| 73 | 540743 | 540943 | + | NC_017554.1 | Pantoea ananatis PA13 |
| 74 | 362231 | 362431 | + | NZ_CP048784.1 | Serratia liquefaciens |
| 75 | 3530282 | 3530482 | - | NZ_CP034148.1 | Pantoea agglomerans |
| 76 | 550995 | 551195 | + | NZ_CP038853.1 | Pantoea vagans |
| 77 | 3894610 | 3894807 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 78 | 239788 | 239985 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 79 | 505594 | 505794 | + | NZ_LT906479.1 | Serratia ficaria |
| 80 | 1881243 | 1881440 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 81 | 3199677 | 3199874 | + | NZ_CP033744.1 | Citrobacter freundii |
| 82 | 3726270 | 3726467 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 83 | 423353 | 423553 | + | NC_015567.1 | Serratia plymuthica AS9 |
| 84 | 3957717 | 3957914 | + | NZ_CP027107.1 | Cronobacter sakazakii |
| 85 | 385240 | 385437 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 86 | 714878 | 715078 | + | NZ_CP065044.1 | Pectobacterium aroidearum |
| 87 | 3855949 | 3856146 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 88 | 3324867 | 3325064 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 89 | 4509204 | 4509401 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 90 | 4404386 | 4404583 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 91 | 5258239 | 5258436 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 92 | 430510 | 430707 | + | NZ_LR134340.1 | Escherichia marmotae |
| 93 | 4443173 | 4443370 | + | NZ_AP014857.1 | Escherichia albertii |
| 94 | 3101199 | 3101399 | - | NZ_CP017482.1 | Pectobacterium polaris |
| 95 | 285358 | 285558 | - | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 96 | 4116782 | 4116982 | - | NZ_CP038498.1 | Pectobacterium punjabense |
| 97 | 363394 | 363594 | + | NZ_LR134494.1 | Serratia quinivorans |
| 98 | 584895 | 585095 | + | NZ_CP051652.1 | Pectobacterium carotovorum |
| 99 | 2911815 | 2912012 | - | NZ_CP038469.1 | Citrobacter tructae |
| 100 | 4008524 | 4008724 | - | NZ_CP006569.1 | Sodalis praecaptivus |
| 101 | 4063163 | 4063363 | - | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 102 | 4842770 | 4842970 | + | NZ_CP016948.1 | Serratia surfactantfaciens |
| 103 | 372823 | 373023 | + | NZ_CP038662.1 | Serratia nematodiphila |
| 104 | 4663059 | 4663259 | - | NZ_CP071320.1 | Serratia ureilytica |
| 105 | 2152263 | 2152463 | + | NZ_CP007230.1 | Yersinia similis |
| 106 | 4296425 | 4296625 | - | NZ_CP034938.1 | Pectobacterium odoriferum |
| 107 | 2254599 | 2254799 | + | NZ_CP047495.1 | Pectobacterium brasiliense |
| 108 | 4267850 | 4268050 | - | NZ_CP009125.1 | Pectobacterium atrosepticum |
| 109 | 4820798 | 4820998 | + | NZ_CP015749.1 | Pectobacterium parmentieri |
| 110 | 1905197 | 1905397 | + | NZ_CP065640.1 | Serratia rubidaea |
| 111 | 602760 | 602960 | + | NC_012880.1 | Musicola paradisiaca Ech703 |
| 112 | 3163764 | 3163964 | + | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 113 | 3330978 | 3331178 | - | NZ_LN907827.1 | Erwinia gerundensis |
| 114 | 251114 | 251302 | + | NZ_AP014524.1 | Vibrio cholerae MS6 |
| 115 | 38064 | 38258 | - | NZ_CP070624.1 | Photobacterium damselae subsp. damselae |
| 116 | 454154 | 454354 | + | NZ_CP032487.1 | Yersinia hibernica |
| 117 | 3617050 | 3617247 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 118 | 469837 | 470034 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 119 | 3215621 | 3215815 | - | NZ_CP071325.1 | Photobacterium ganghwense |
| 120 | 4120667 | 4120864 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 121 | 1442213 | 1442410 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 122 | 2854543 | 2854731 | + | NZ_CP035688.1 | Vibrio metoecus |
| 123 | 3113836 | 3114021 | + | NZ_CP044069.1 | Vibrio vulnificus |
| 124 | 1582238 | 1582432 | + | NZ_CP014056.2 | Grimontia hollisae |
| 125 | 48755 | 48949 | - | NZ_CP005974.1 | Photobacterium gaetbulicola Gung47 |
| 126 | 239917 | 240105 | + | NZ_CP022741.1 | Vibrio qinghaiensis |
| 127 | 288840 | 289025 | - | NZ_CP031781.1 | Vibrio parahaemolyticus |
| 128 | 2944703 | 2944888 | - | NZ_LT960611.1 | Vibrio tapetis subsp. tapetis |
| 129 | 259529 | 259714 | - | NZ_CP032093.1 | Vibrio alfacsensis |
| 130 | 2962307 | 2962492 | - | NZ_CP009354.1 | Vibrio tubiashii ATCC 19109 |
| 131 | 1184399 | 1184587 | + | NZ_CP065150.1 | Vibrio kanaloae |
| 132 | 2469386 | 2469574 | - | NZ_CP014035.2 | Vibrio fluvialis |
| 133 | 3411071 | 3411259 | - | NZ_CP046268.1 | Vibrio spartinae |
| 134 | 2118406 | 2118591 | - | NZ_CP019959.1 | Vibrio owensii |
| 135 | 86066 | 86251 | - | NZ_CP018312.1 | Vibrio rotiferianus |
| 136 | 267122 | 267310 | - | NC_011753.2 | Vibrio atlanticus |
| 137 | 3537515 | 3537700 | + | NZ_CP009467.1 | Vibrio harveyi |
| 138 | 3006012 | 3006200 | + | NZ_CP039700.1 | Vibrio cyclitrophicus |
| 139 | 2539646 | 2539831 | - | NZ_CP025792.1 | Vibrio jasicida 090810c |
| 140 | 2961447 | 2961632 | + | NZ_CP030788.1 | Vibrio campbellii |
| 141 | 306959 | 307144 | + | NZ_AP019651.1 | Vibrio taketomensis |
| 142 | 714722 | 714907 | - | NC_013456.1 | Vibrio antiquarius |
| 143 | 308224 | 308409 | + | NZ_CP045350.1 | Vibrio aquimaris |
| 144 | 2587342 | 2587527 | - | NZ_AP019657.1 | Vibrio ponticus |
| 145 | 778073 | 778261 | + | NZ_CP040990.1 | Vibrio furnissii |
| 146 | 94390 | 94575 | + | NZ_CP016414.1 | Vibrio scophthalmi |
| 147 | 1750912 | 1751112 | + | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 148 | 3163481 | 3163666 | - | NZ_CP009977.1 | Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 |
| 149 | 2795619 | 2795804 | - | NZ_CP047475.1 | Vibrio astriarenae |
| 150 | 3242455 | 3242619 | - | NC_013961.1 | Erwinia amylovora CFBP1430 |
| 151 | 2355471 | 2355671 | - | NZ_CP049115.1 | Pantoea stewartii |
| 152 | 2557030 | 2557206 | - | NZ_CP040021.1 | Salinivibrio kushneri |
| 153 | 3303347 | 3303547 | - | NC_010694.1 | Erwinia tasmaniensis Et1/99 |
| 154 | 1576961 | 1577128 | - | NZ_CP036200.1 | Shewanella maritima |
| 155 | 3349005 | 3349205 | + | NZ_CP009787.1 | Yersinia rohdei |
| 156 | 4222262 | 4222462 | - | NZ_CP011118.1 | Yersinia enterocolitica |
| 157 | 4391580 | 4391768 | - | NZ_CP034015.1 | Shewanella livingstonensis |
| 158 | 3999303 | 3999473 | - | NZ_CP041036.1 | Shewanella polaris |
| 159 | 2547640 | 2547810 | - | NZ_CP041783.1 | Shewanella donghaensis |
| 160 | 516348 | 516548 | + | NZ_CP043727.1 | Yersinia canariae |
| 161 | 4209639 | 4209839 | - | NZ_CP046293.1 | Yersinia intermedia |
| 162 | 446080 | 446250 | + | NZ_CP031769.1 | Salinimonas sediminis |
| 163 | 1417026 | 1417214 | - | NZ_CP007030.1 | Thiomicrospira aerophila AL3 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003197.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01715.19 | 0.86 | 139 | 4194.0 | same-strand | IPP transferase |
| 2 | PF17209.5 | 0.96 | 155 | 3790.5 | same-strand | Hfq protein |
| 3 | PF13167.8 | 0.96 | 156 | 2434 | same-strand | GTP-binding GTPase N-terminal |
| 4 | PF16360.7 | 0.96 | 156 | 2434 | same-strand | GTP-binding GTPase Middle Region |
| 5 | PF01926.25 | 0.96 | 156 | 2434 | same-strand | 50S ribosome-binding GTPase |
| 6 | PF02421.20 | 0.96 | 155 | 2434.0 | same-strand | Ferrous iron transport protein B |
| 7 | PF01145.27 | 0.97 | 157 | 1044.0 | same-strand | SPFH domain / Band 7 family |
| 8 | PF12221.10 | 0.96 | 156 | 1082 | same-strand | Bacterial membrane protein N terminal |
| 9 | PF00709.23 | 0.92 | 149 | 103.0 | same-strand | Adenylosuccinate synthetase |
| 10 | PF02082.22 | 0.7 | 113 | 1626.5 | same-strand | Iron-dependent Transcriptional regulator |
| 11 | PF00773.21 | 0.75 | 122 | 2115 | same-strand | RNB domain |
| 12 | PF08206.13 | 0.75 | 122 | 2115 | same-strand | Ribonuclease B OB domain |
| 13 | PF17876.3 | 0.75 | 122 | 2115 | same-strand | Cold shock domain |
| 14 | PF00575.25 | 0.75 | 122 | 2115 | same-strand | S1 RNA binding domain |
| 15 | PF08461.12 | 0.75 | 122 | 2115 | same-strand | Ribonuclease R winged-helix domain |
| 16 | PF00588.21 | 0.63 | 102 | 4661 | same-strand | SpoU rRNA Methylase family |
| 17 | PF08032.14 | 0.63 | 102 | 4661 | same-strand | RNA 2'-O ribose methyltransferase substrate binding |
++ More..