Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01114 |
NCBI Accession ID | NC_016810.1 |
Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 |
Left | 3422443 |
Right | 3422607 |
Strand | + |
Nucleotide Sequence | ATGAGCAAAAAATCGGCGAAGAAACGTCAGCCCGTGGTAAAACCTGCCGTACAGGAGGCGATGAGCGCCGCTGTGCCGCTGGGCTATGAAGAGATGCTAACCGAACTGGAAGCCATCGTGGCGGACGCCGAAGCCCGGCTGGCAGAAGAAGAGGCCGCAGCCTGA |
Sequence | MSKKSAKKRQPVVKPAVQEAMSAAVPLGYEEMLTELEAIVADAEARLAEEEAAA |
Source of smORF | Protein-level |
Function | |
Pubmed ID | Venturini et al 2020 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | P42625 |
ORF Length (Amino Acid) | 54 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3401745 | 3401909 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
2 | 1263386 | 1263550 | + | NZ_CP053416.1 | Salmonella bongori |
3 | 3244429 | 3244593 | + | NZ_AP014857.1 | Escherichia albertii |
4 | 4168073 | 4168237 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
5 | 4028090 | 4028251 | - | NZ_CP038469.1 | Citrobacter tructae |
6 | 3010852 | 3011001 | - | NZ_CP044098.1 | Citrobacter portucalensis |
7 | 3994800 | 3994964 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
8 | 548498 | 548662 | - | NZ_CP061527.1 | Shigella dysenteriae |
9 | 3768703 | 3768867 | + | NZ_LR134340.1 | Escherichia marmotae |
10 | 3255043 | 3255207 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
11 | 3246470 | 3246634 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
12 | 2064328 | 2064477 | + | NZ_CP033744.1 | Citrobacter freundii |
13 | 5260394 | 5260555 | + | NZ_CP045205.1 | Citrobacter telavivensis |
14 | 1850306 | 1850467 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
15 | 273406 | 273576 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
16 | 5013160 | 5013321 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
17 | 593901 | 594062 | - | NZ_CP050508.1 | Raoultella terrigena |
18 | 4690351 | 4690518 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
19 | 2151112 | 2151276 | + | NZ_CP057657.1 | Escherichia fergusonii |
20 | 509996 | 510172 | - | NZ_CP012264.1 | Cronobacter condimenti 1330 |
21 | 2287058 | 2287222 | - | NZ_CP042941.1 | Atlantibacter hermannii |
22 | 1137588 | 1137755 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
23 | 5307657 | 5307824 | - | NZ_CP011602.1 | Phytobacter ursingii |
24 | 585951 | 586118 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
25 | 507327 | 507503 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
26 | 638676 | 638834 | - | NZ_CP045845.1 | Kluyvera intermedia |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF07681.14 | 0.68 | 17 | 3326 | same-strand | DoxX |
2 | PF13409.8 | 0.8 | 20 | 2286 | same-strand | Glutathione S-transferase, N-terminal domain |
3 | PF13410.8 | 0.72 | 18 | 2337 | same-strand | Glutathione S-transferase, C-terminal domain |
4 | PF05656.16 | 0.8 | 20 | 1776 | same-strand | Protein of unknown function (DUF805) |
5 | PF03466.22 | 0.92 | 23 | 830.5 | opposite-strand | LysR substrate binding domain |
6 | PF00126.29 | 0.96 | 24 | 830 | opposite-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
7 | PF02678.18 | 0.96 | 24 | 25 | same-strand | Pirin |
8 | PF17954.3 | 0.96 | 24 | 25 | same-strand | Quercetinase C-terminal cupin domain |
9 | PF03313.17 | 0.64 | 16 | 328.5 | opposite-strand | Serine dehydratase alpha chain |
10 | PF03315.17 | 0.6 | 15 | 3122.5 | opposite-strand | Serine dehydratase beta chain |