Result : EXP01112
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01112 |
| NCBI Accession ID | NC_016810.1 |
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 |
| Left | 1316925 |
| Right | 1317122 |
| Strand | + |
| Nucleotide Sequence | ATGAAACGATTTAAAGAAATGGCAACAATTTTTCTTTTTGCATTGCTGGCTGCGGGGTTCACGTCGTCTGCTATGGCAGCGTCGGGTAGTGATAGTCCGTGGGATTTTGATTTTTCGGGTCCATGGCTTTTTTGCAAACTACAACCCCCTGATTCTCTGCAATTACCGCCACCTCCTGGTGAGTATTGCTGGCATTAA |
| Sequence | MKRFKEMATIFLFALLAAGFTSSAMAASGSDSPWDFDFSGPWLFCKLQPPDSLQLPPPPGEYCWH |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | Venturini et al 2020 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 65 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1360063 | 1360260 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 3764988 | 3765191 | + | NZ_CP053416.1 | Salmonella bongori |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003197.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12833.9 | 1.0 | 2 | 3102.5 | same-strand | Helix-turn-helix domain |
| 2 | PF04284.15 | 1.0 | 2 | 2666.0 | opposite-strand | Protein of unknown function (DUF441) |
| 3 | PF04073.17 | 1.0 | 2 | 1828.5 | opposite-strand | Aminoacyl-tRNA editing domain |
| 4 | PF17155.6 | 1.0 | 2 | 294.5 | opposite-strand | Gammaproteobacterial periplasmic sensor domain |
| 5 | PF00990.23 | 1.0 | 2 | 294.5 | opposite-strand | Diguanylate cyclase, GGDEF domain |
| 6 | PF04285.14 | 1.0 | 2 | 152.5 | opposite-strand | Protein of unknown function (DUF444) |
| 7 | PF08298.13 | 1.0 | 2 | 1560.0 | opposite-strand | PrkA AAA domain |
| 8 | PF06798.14 | 1.0 | 2 | 1560.0 | opposite-strand | PrkA serine protein kinase C-terminal domain |
| 9 | PF06629.14 | 1.0 | 2 | 3891.5 | same-strand | MltA-interacting protein MipA |
| 10 | PF13505.8 | 1.0 | 2 | 3891.5 | same-strand | Outer membrane protein beta-barrel domain |
| 11 | PF04055.23 | 1.0 | 2 | 4973.0 | same-strand | Radical SAM superfamily |
| 12 | PF13186.8 | 1.0 | 2 | 4973.0 | same-strand | Iron-sulfur cluster-binding domain |
| 13 | PF00248.23 | 1.0 | 2 | 6330.0 | same-strand | Aldo/keto reductase family |
++ More..