ProsmORF-pred
Result : A0QQ43
Protein Information
Information Type Description
Protein name ESAT-6-like protein EsxG
NCBI Accession ID CP000480.1
Organism Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis)
Left 701225
Right 701518
Strand +
Nucleotide Sequence ATGAGTCTTCTCGACGCTCACATCCCCCAGCTGATCGCGTCCGAGGCCAACTTCGGCGCCAAGGCCGCCCTGATGCGCAGCACCATCGCCCAGGCCGAGCAGGCCGCGATGAGTTCGCAGGCCTTCCACATGGGTGAGGCCTCCGCGGCCTTCCAGGCCGCGCATGCCCGTTTCGTCGAGGTCTCGGCCAAGGTCAATGCGCTGCTCGACATCGCGCAGCTCAACATCGGCGACGCGGCCTCGAGCTACGTCGCGCAGGACGCCGCCGCGGCCAGCACCTACACCGGTATCTGA
Sequence MSLLDAHIPQLIASEANFGAKAALMRSTIAQAEQAAMSSQAFHMGEASAAFQAAHARFVEVSAKVNALLDIAQLNIGDAASSYVAQDAAAASTYTGI
Source of smORF Swiss-Prot
Function
Pubmed ID 17295914 18955433 24803520 24312350
Domain
Functional Category Others
Uniprot ID A0QQ43
ORF Length (Amino Acid) 97
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 77
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 737887 738180 + NZ_LN831039.1 Mycolicibacterium smegmatis
2 507622 507915 - NZ_CP012150.1 Mycobacterium goodii
3 4484222 4484515 - NZ_AP022617.1 Mycolicibacterium monacense
4 406452 406745 + NZ_CP011491.1 Mycolicibacterium vaccae 95051
5 4498793 4499086 - NZ_LR134355.1 Mycolicibacterium chitae
6 1769969 1770262 + NZ_AP022588.1 Mycolicibacterium sediminis
7 3939269 3939562 - NZ_AP022586.1 Mycolicibacterium litorale
8 5375529 5375822 - NZ_AP022561.1 Mycolicibacterium aichiense
9 2221261 2221554 - NZ_CP007220.1 Mycobacteroides chelonae CCUG 47445
10 47400 47693 + NZ_CP007220.1 Mycobacteroides chelonae CCUG 47445
11 623780 624073 + NZ_CP007220.1 Mycobacteroides chelonae CCUG 47445
12 4521088 4521381 - NZ_AP022612.1 Mycolicibacterium confluentis
13 1901068 1901361 - NZ_AP022596.1 Mycolicibacterium helvum
14 4077079 4077372 + NZ_AP022596.1 Mycolicibacterium helvum
15 1861186 1861479 + NZ_AP022579.1 Mycolicibacterium boenickei
16 41570 41863 + NZ_CP024633.1 Mycobacteroides salmoniphilum
17 573306 573599 + NZ_CP024633.1 Mycobacteroides salmoniphilum
18 1970129 1970422 - NZ_CP024633.1 Mycobacteroides salmoniphilum
19 1504700 1504993 - NZ_AP022567.1 Mycolicibacterium mageritense
20 3211563 3211856 - NZ_AP022565.1 Mycolicibacterium alvei
21 566854 567147 + NZ_CP011269.1 Mycolicibacterium fortuitum
22 1958157 1958450 + NZ_AP022595.1 Mycolicibacterium sarraceniae
23 3598044 3598337 + NZ_AP022595.1 Mycolicibacterium sarraceniae
24 2150803 2151096 - NZ_AP018165.1 [Mycobacterium] stephanolepidis
25 615606 615899 + NZ_AP018165.1 [Mycobacterium] stephanolepidis
26 50906 51199 + NZ_AP018165.1 [Mycobacterium] stephanolepidis
27 51601 51894 + NZ_CP010271.1 Mycobacteroides saopaulense
28 1957681 1957974 - NZ_CP010271.1 Mycobacteroides saopaulense
29 578340 578633 + NZ_CP010271.1 Mycobacteroides saopaulense
30 653202 653495 + NZ_CP014955.1 Mycobacteroides abscessus
31 45777 46070 + NZ_CP014955.1 Mycobacteroides abscessus
32 2258849 2259142 - NZ_CP014955.1 Mycobacteroides abscessus
33 6825422 6825715 - NZ_CP020809.1 Mycobacterium dioxanotrophicus
34 1015988 1016281 - NZ_AP022600.1 Mycolicibacterium tokaiense
35 2388464 2388754 - NZ_CP011530.1 Mycobacteroides immunogenum
36 103941 104231 + NZ_CP011530.1 Mycobacteroides immunogenum
37 784655 784945 + NZ_CP011530.1 Mycobacteroides immunogenum
38 956888 957181 + NZ_AP022570.1 Mycolicibacterium poriferae
39 490637 490930 + NZ_LR130759.1 Mycobacterium basiliense
40 4137062 4137355 - NZ_AP022563.1 Mycolicibacterium duvalii
41 2508912 2509205 - NZ_AP022603.1 Mycolicibacterium fallax
42 955695 955985 + NZ_AP022618.1 Mycolicibacterium insubricum
43 394408 394701 + NZ_LR134356.1 Mycolicibacterium aurum
44 2145370 2145663 + NZ_AP022589.1 Mycolicibacter minnesotensis
45 89442 89735 - NZ_AP022589.1 Mycolicibacter minnesotensis
46 18404 18697 - NZ_AP022560.1 Mycolicibacterium moriokaense
47 4055861 4056154 + NZ_AP022609.1 Mycolicibacter hiberniae
48 4066906 4067199 + NZ_AP022609.1 Mycolicibacter hiberniae
49 1966555 1966848 - NZ_AP022609.1 Mycolicibacter hiberniae
50 285897 286190 + NZ_LT906469.1 Mycolicibacter terrae
51 296992 297285 + NZ_LT906469.1 Mycolicibacter terrae
52 1641310 1641603 - NZ_AP022562.1 Mycobacterium novum
53 1652396 1652689 - NZ_AP022562.1 Mycobacterium novum
54 455125 455418 + NC_008726.1 Mycolicibacterium vanbaalenii PYR-1
55 3714039 3714332 + NC_022663.1 Mycobacterium kansasii ATCC 12478
56 3008526 3008819 - NC_022663.1 Mycobacterium kansasii ATCC 12478
57 3724678 3724971 + NC_022663.1 Mycobacterium kansasii ATCC 12478
58 1580614 1580907 - NC_022663.1 Mycobacterium kansasii ATCC 12478
59 3229529 3229789 + NC_022663.1 Mycobacterium kansasii ATCC 12478
60 815100 815393 + NC_022663.1 Mycobacterium kansasii ATCC 12478
61 316327 316620 + NC_015576.1 Mycolicibacter sinensis
62 305242 305535 + NC_015576.1 Mycolicibacter sinensis
63 678815 679108 + NZ_CP025546.1 Mycobacterium paragordonae
64 3093693 3093986 - NZ_AP022593.1 Mycolicibacterium arabiense
65 512244 512537 + NZ_AP018164.1 Mycobacterium shigaense
66 2501500 2501793 + NZ_AP018164.1 Mycobacterium shigaense
67 3911734 3912027 - NZ_AP022590.1 Mycobacterium mantenii
68 4838211 4838504 - NZ_CP023147.1 Mycobacterium marseillense
69 4998414 4998707 - NC_016946.1 Mycobacterium intracellulare ATCC 13950
70 5101587 5101880 - NC_016948.1 Mycobacterium paraintracellulare
71 4795087 4795380 - NZ_CP009360.4 Mycobacterium avium subsp. hominissuis
72 4316526 4316819 + NZ_AP022572.1 Mycobacterium shottsii
73 1868176 1868469 + NZ_AP022572.1 Mycobacterium shottsii
74 4998555 4998848 - NZ_CP058277.1 Mycobacterium marinum
75 2078368 2078661 + NZ_CP058277.1 Mycobacterium marinum
76 4809406 4809699 + NZ_AP022581.1 Mycobacterium lacus
77 3166593 3166886 - NZ_AP022581.1 Mycobacterium lacus
78 4134363 4134656 - NZ_AP022581.1 Mycobacterium lacus
79 4717637 4717930 + NZ_AP022608.1 Mycolicibacterium gadium
80 3141059 3141352 - NZ_AP022576.1 Mycobacterium florentinum
81 1934330 1934623 - NZ_AP022599.1 Mycolicibacterium pulveris
82 3452221 3452514 - NZ_AP022587.1 Mycobacterium stomatepiae
83 4855938 4856231 + NZ_AP022601.1 Mycobacterium gallinarum
84 3904609 3904902 + NZ_AP022577.1 Mycolicibacterium aubagnense
85 3378565 3378858 - NZ_AP022616.1 Mycolicibacterium phocaicum
86 3349670 3349960 - NZ_AP018410.1 Mycobacterium pseudoshottsii JCM 15466
87 720837 721130 + NZ_AP018410.1 Mycobacterium pseudoshottsii JCM 15466
88 2938604 2938900 - NZ_CP029543.1 Mycobacterium leprae
89 1850601 1850897 + NZ_AP022606.1 Mycobacterium branderi
90 292917 293210 - NZ_AP022606.1 Mycobacterium branderi
91 4418000 4418296 - NZ_AP022606.1 Mycobacterium branderi
92 1117369 1117665 - NZ_AP022606.1 Mycobacterium branderi
93 734992 735285 + NC_014168.1 Segniliparus rotundus DSM 44985
94 385224 385517 + NZ_CP062008.1 Mycolicibacterium mucogenicum DSM 44124
95 4914077 4914370 + NZ_LR026975.1 Mycolicibacterium hassiacum DSM 44199
96 4109436 4109729 + NZ_AP022573.1 Mycobacterium saskatchewanense
97 4522648 4522941 + NZ_AP022619.1 Mycobacterium paraseoulense
98 1637667 1637960 - NZ_AP022615.1 Mycobacterium heidelbergense
99 3764873 3765166 - NZ_AP022614.1 Mycobacterium parmense
100 3739649 3739942 - NZ_AP022614.1 Mycobacterium parmense
101 2109056 2109349 - NZ_AP022568.1 Mycobacterium simiae
102 997372 997665 - NZ_AP022598.1 Mycolicibacterium parafortuitum
103 351525 351818 + NC_000962.3 Mycobacterium tuberculosis H37Rv
104 3379036 3379329 - NC_000962.3 Mycobacterium tuberculosis H37Rv
105 362025 362318 + NC_015848.1 Mycobacterium canettii CIPT 140010059
106 3441747 3442040 - NC_015848.1 Mycobacterium canettii CIPT 140010059
107 4723783 4724076 + NZ_AP022582.1 Mycobacterium seoulense
108 3490722 3491015 - NZ_AP022575.1 Mycobacterium shinjukuense
109 724001 724294 + NZ_AP022575.1 Mycobacterium shinjukuense
110 2205534 2205827 + NZ_AP022583.1 Mycobacterium noviomagense
111 4538667 4538960 - NZ_AP024310.1 Mycobacterium heckeshornense
112 435982 436275 + NZ_AP024310.1 Mycobacterium heckeshornense
113 350129 350431 + NZ_LT906483.1 Mycolicibacterium thermoresistibile
114 1767381 1767674 + NZ_CP043474.1 Mycobacterium grossiae
115 516824 517117 + NZ_AP022569.1 Mycobacterium cookii
116 3885669 3885962 + NZ_AP022569.1 Mycobacterium cookii
117 368746 369048 + NZ_CP011883.2 Mycobacterium haemophilum DSM 44634
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_CP012150.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF00004.31 0.96 74 7458.0 same-strand ATPase family associated with various cellular activities (AAA)
2 PF05108.15 1.0 77 5887 same-strand Type VII secretion system ESX-1, transport TM domain B
3 PF01580.20 1.0 77 1909 same-strand FtsK/SpoIIIE family
4 PF00934.22 1.0 77 1585.0 same-strand PE family
5 PF00823.21 0.96 74 56.0 same-strand PPE family
6 PF18878.2 0.95 73 55.0 same-strand PPE-PPW subfamily C-terminal region
7 PF06013.14 1.0 77 31 same-strand Proteins of 100 residues with WXG
8 PF14011.8 1.0 77 334 same-strand EspG family
9 PF08817.12 1.0 77 1261.0 same-strand WXG100 protein secretion system (Wss), protein YukD
10 PF00082.24 1.0 77 2676 same-strand Subtilase family
11 PF11203.10 0.84 65 4071.5 same-strand Putative type VII ESX secretion system translocon, EccE
++ More..