Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01107 |
NCBI Accession ID | NC_000913.3 |
Organism | Escherichia coli str. K-12 substr. MG1655 |
Left | 754674 |
Right | 754781 |
Strand | - |
Nucleotide Sequence | ATGCGTAAAAGTTATGAAGTCGGTATTTCACCTAAGATTAACTTATGTAACAGTGTGGAAGTATTGACCAATTCATTCGGGACAGTTATTAGTGGTAGACAAGTTTAA |
Sequence | MRKSYEVGISPKINLCNSVEVLTNSFGTVISGRQV |
Source of smORF | Protein-level |
Function | INDUCTION: Expressed in both exponential and stationary phase; expression is higher during stationary phase (at protein level) Pubmed:29645342,30837344 |
Pubmed ID | 19121005 29645342 30837344 |
Domain | |
Functional Category | Gene Ontology/Expression based functional assignment |
Uniprot ID | P0DPN5 |
ORF Length (Amino Acid) | 35 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 831320 | 831427 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
2 | 754674 | 754781 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
3 | 602272 | 602379 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
4 | 2992213 | 2992320 | + | NZ_CP061527.1 | Shigella dysenteriae |
5 | 744056 | 744163 | - | NZ_AP014857.1 | Escherichia albertii |
6 | 1385328 | 1385435 | - | NZ_LR134340.1 | Escherichia marmotae |
7 | 2256050 | 2256157 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
8 | 3456769 | 3456876 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
9 | 1436811 | 1436921 | + | NZ_CP057657.1 | Escherichia fergusonii |
10 | 1459835 | 1459942 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
11 | 1448606 | 1448692 | - | NZ_CP015113.1 | Kosakonia radicincitans |
12 | 3759829 | 3759915 | + | NZ_CP014007.2 | Kosakonia oryzae |
13 | 1539293 | 1539379 | + | NZ_CP045300.1 | Kosakonia arachidis |
14 | 1628463 | 1628564 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
15 | 3245910 | 3246017 | + | NZ_CP035129.1 | Kosakonia cowanii |
16 | 2592238 | 2592345 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
17 | 4122613 | 4122717 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00285.23 | 1.0 | 16 | 206 | same-strand | Citrate synthase, C-terminal domain |
2 | PF01127.24 | 1.0 | 16 | 559.5 | opposite-strand | Succinate dehydrogenase/Fumarate reductase transmembrane subunit |
3 | PF00890.26 | 1.0 | 16 | 1126 | opposite-strand | FAD binding domain |
4 | PF02910.22 | 1.0 | 16 | 1126 | opposite-strand | Fumarate reductase flavoprotein C-term |
5 | PF13085.8 | 1.0 | 16 | 2908 | opposite-strand | 2Fe-2S iron-sulfur cluster binding domain |
6 | PF13534.8 | 1.0 | 16 | 2908 | opposite-strand | 4Fe-4S dicluster domain |
7 | PF13183.8 | 1.0 | 16 | 2908 | opposite-strand | 4Fe-4S dicluster domain |
8 | PF13237.8 | 1.0 | 16 | 2908 | opposite-strand | 4Fe-4S dicluster domain |
9 | PF02779.26 | 1.0 | 16 | 3925 | opposite-strand | Transketolase, pyrimidine binding domain |
10 | PF16870.7 | 1.0 | 16 | 3925 | opposite-strand | 2-oxoglutarate dehydrogenase C-terminal |
11 | PF00676.22 | 1.0 | 16 | 3925 | opposite-strand | Dehydrogenase E1 component |
12 | PF16078.7 | 1.0 | 16 | 3925 | opposite-strand | 2-oxoglutarate dehydrogenase N-terminus |