Result : EXP01097
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01097 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 313141 |
| Right | 313242 |
| Strand | - |
| Nucleotide Sequence | ATGAAAGAGAATAAAGTACAGCAAATCAGTCATAAACTGATTAATATCGTTGTTTTTGTCGCAATTGTAGAATACGCCTATTTATTTCTCCATTTCTATTAA |
| Sequence | MKENKVQQISHKLINIVVFVAIVEYAYLFLHFY |
| Source of smORF | Protein-level |
| Function | integral component of membrane [GO:0016021]; plasma membrane [GO:0005886];INDUCTION: Constitutively expressed (Pubmed:19121005), repressed in minimal glucose medium, by SDS/EDTA (envelope stress), at 10 degrees Celsius and H(2)O(2), induced in minimal glycerol medium, by thiol oxidant diamide, strongly induced at 45 degrees Celsius (Pubmed:19734316) (at protein level) Transcription is dependent on CRP Pubmed:19121005,19734316 |
| Pubmed ID | 19121005 29645342 30837344 |
| Domain | |
| Functional Category | Gene Ontology/Expression based functional assignment |
| Uniprot ID | C1P5Z8 |
| ORF Length (Amino Acid) | 33 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 313141 | 313242 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 1735937 | 1736038 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 3 | 944170 | 944271 | - | NZ_LR134340.1 | Escherichia marmotae |
| 4 | 2725884 | 2725985 | + | NZ_AP014857.1 | Escherichia albertii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00444.20 | 0.75 | 3 | 724 | same-strand | Ribosomal protein L36 |
| 2 | PF01197.20 | 0.75 | 3 | 461 | same-strand | Ribosomal protein L31 |
++ More..