Result : EXP01095
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01095 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 1344436 |
| Right | 1344609 |
| Strand | - |
| Nucleotide Sequence | ATGTCTGAATTTGATGCCCAGCGCGTTGCCGAACGTATTGATATTGTGTTAGATATCCTTGTGGCAGGCGATTACCACTCTGCGATCCATAATCTCGAGATACTTAAAGCAGAACTCTTGCGCCAGGTTGCTGAATCTACGCCAGACATCCCGAAGGCACCGTGGGAGATTTAA |
| Sequence | MSEFDAQRVAERIDIVLDILVAGDYHSAIHNLEILKAELLRQVAESTPDIPKAPWEI |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of PRK13658. Profile Description: hypothetical protein; Provisional |
| Pubmed ID | 19121005 29645342 30837344 |
| Domain | CDD:184215 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | A7MMF2 |
| ORF Length (Amino Acid) | 57 |
++ More..
| Conservation Analysis |
No. of Species: 61
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2351078 | 2351251 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 2 | 1344436 | 1344609 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 1338720 | 1338893 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 2392007 | 2392180 | + | NZ_LR134340.1 | Escherichia marmotae |
| 5 | 1845279 | 1845452 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 6 | 1393281 | 1393454 | - | NZ_AP014857.1 | Escherichia albertii |
| 7 | 1329665 | 1329847 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 8 | 1828062 | 1828244 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 9 | 368800 | 368982 | + | NZ_CP033744.1 | Citrobacter freundii |
| 10 | 4700958 | 4701140 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 11 | 1391369 | 1391551 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 12 | 3982736 | 3982918 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 13 | 703732 | 703908 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 14 | 2968839 | 2969021 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 15 | 1136326 | 1136508 | + | NZ_CP038469.1 | Citrobacter tructae |
| 16 | 2547808 | 2547990 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 17 | 1769869 | 1770051 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 18 | 458482 | 458664 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 19 | 3313661 | 3313843 | + | NZ_CP050508.1 | Raoultella terrigena |
| 20 | 2632077 | 2632259 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 21 | 4310029 | 4310211 | + | NZ_CP053416.1 | Salmonella bongori |
| 22 | 1798640 | 1798819 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 23 | 2534342 | 2534524 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 24 | 2796427 | 2796609 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 25 | 4015926 | 4016108 | - | NZ_CP026047.1 | Raoultella planticola |
| 26 | 3208087 | 3208269 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 27 | 2108975 | 2109157 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 28 | 3501787 | 3501969 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 29 | 4686627 | 4686809 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 30 | 3028641 | 3028823 | + | NZ_CP041247.1 | Raoultella electrica |
| 31 | 2537968 | 2538150 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 32 | 2543182 | 2543364 | + | NC_015968.1 | Enterobacter soli |
| 33 | 2575037 | 2575219 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 34 | 2581846 | 2582028 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 35 | 3277753 | 3277935 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 36 | 3358911 | 3359093 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 37 | 4132688 | 4132870 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 38 | 867256 | 867438 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 39 | 1075650 | 1075832 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 40 | 2375857 | 2376039 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 41 | 1846723 | 1846905 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 42 | 1645594 | 1645776 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 43 | 2309540 | 2309722 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 44 | 2377563 | 2377745 | + | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 45 | 2224866 | 2225048 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 46 | 2056941 | 2057123 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 47 | 530353 | 530535 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 48 | 3159820 | 3159999 | + | NZ_CP054254.1 | Klebsiella variicola |
| 49 | 2235153 | 2235332 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 50 | 2588889 | 2589071 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 51 | 2973493 | 2973672 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 52 | 2990648 | 2990830 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 53 | 4080205 | 4080387 | + | NZ_CP040428.1 | Jejubacter calystegiae |
| 54 | 2523642 | 2523824 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 55 | 1704130 | 1704312 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 56 | 481117 | 481299 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 57 | 2240948 | 2241130 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 58 | 2025792 | 2025974 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 59 | 2665389 | 2665571 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 60 | 1903637 | 1903819 | + | NZ_LR134201.1 | Cedecea lapagei |
| 61 | 2174209 | 2174391 | - | NZ_CP023525.1 | Cedecea neteri |
| 62 | 2176201 | 2176383 | - | NZ_AP023184.1 | Buttiauxella agrestis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00563.22 | 0.79 | 48 | 1058.5 | same-strand | EAL domain |
| 2 | PF00455.24 | 0.97 | 59 | 88.5 | same-strand | DeoR C terminal sensor domain |
| 3 | PF08220.14 | 0.9 | 55 | 88.0 | same-strand | DeoR-like helix-turn-helix domain |
| 4 | PF01253.24 | 0.84 | 51 | 1435.0 | opposite-strand | Translation initiation factor SUI1 |
| 5 | PF00215.26 | 0.84 | 51 | 1760.5 | opposite-strand | Orotidine 5'-phosphate decarboxylase / HUMPS family |
| 6 | PF14559.8 | 0.7 | 43 | 2684.5 | opposite-strand | Tetratricopeptide repeat |
| 7 | PF18073.3 | 0.82 | 50 | 2687 | opposite-strand | Rubredoxin metal binding domain |
| 8 | PF13424.8 | 0.75 | 46 | 2687 | opposite-strand | Tetratricopeptide repeat |
| 9 | PF05433.17 | 0.95 | 58 | 1100 | same-strand | Glycine zipper 2TM domain |
| 10 | PF13488.8 | 0.82 | 50 | 1100 | same-strand | Glycine zipper |
| 11 | PF00990.23 | 0.75 | 46 | 1058 | same-strand | Diguanylate cyclase, GGDEF domain |
| 12 | PF13426.9 | 0.74 | 45 | 1058.5 | same-strand | PAS domain |
| 13 | PF00989.27 | 0.72 | 44 | 1059 | same-strand | PAS fold |
| 14 | PF00773.21 | 0.98 | 60 | 2440 | same-strand | RNB domain |
| 15 | PF08206.13 | 0.98 | 60 | 2440 | same-strand | Ribonuclease B OB domain |
| 16 | PF00575.25 | 0.98 | 60 | 2440 | same-strand | S1 RNA binding domain |
| 17 | PF17876.3 | 0.98 | 60 | 2440 | same-strand | Cold shock domain |
| 18 | PF13561.8 | 0.9 | 55 | 5816.0 | same-strand | Enoyl-(Acyl carrier protein) reductase |
| 19 | PF00106.27 | 0.9 | 55 | 5816.0 | same-strand | short chain dehydrogenase |
++ More..