Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01084 |
NCBI Accession ID | NC_000913.3 |
Organism | Escherichia coli str. K-12 substr. MG1655 |
Left | 3032817 |
Right | 3032942 |
Strand | + |
Nucleotide Sequence | ATGAATTTTTTAATGCGCGCTATATTCAGTCTGTTGTTGCTTTTTACTCTCTCTATTCCTGTCATTTCTGACTGTGTTGCAATGGCCATTGAAAGTCGCTTCAAATATATGATGCTACTTTTTTAA |
Sequence | MNFLMRAIFSLLLLFTLSIPVISDCVAMAIESRFKYMMLLF |
Source of smORF | Protein-level |
Function | INDUCTION: In stationary phase (at protein level) Pubmed:19121005 |
Pubmed ID | 19121005 29645342 30837344 |
Domain | |
Functional Category | Gene Ontology/Expression based functional assignment |
Uniprot ID | C1P614 |
ORF Length (Amino Acid) | 41 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3771094 | 3771219 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
2 | 3032817 | 3032942 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
3 | 2966732 | 2966857 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
4 | 3510423 | 3510548 | + | NZ_LR134340.1 | Escherichia marmotae |
5 | 2968731 | 2968856 | + | NZ_AP014857.1 | Escherichia albertii |
6 | 988057 | 988179 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
7 | 339398 | 339523 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01979.22 | 0.83 | 5 | 5725.5 | same-strand | Amidohydrolase family |
2 | PF00860.22 | 1.0 | 6 | 1514 | same-strand | Permease family |
3 | PF00293.30 | 1.0 | 6 | 123 | same-strand | NUDIX domain |
4 | PF00152.22 | 1.0 | 6 | 715 | opposite-strand | tRNA synthetases class II (D, K and N) |
5 | PF01336.27 | 1.0 | 6 | 715 | opposite-strand | OB-fold nucleic acid binding domain |
6 | PF00472.22 | 1.0 | 6 | 2242 | opposite-strand | RF-1 domain |
7 | PF02272.21 | 1.0 | 6 | 3431 | opposite-strand | DHHA1 domain |
8 | PF01368.22 | 1.0 | 6 | 3431 | opposite-strand | DHH family |
9 | PF17768.3 | 1.0 | 6 | 3431 | opposite-strand | RecJ OB domain |
10 | PF13098.8 | 1.0 | 6 | 5170 | opposite-strand | Thioredoxin-like domain |
11 | PF10411.11 | 1.0 | 6 | 5170 | opposite-strand | Disulfide bond isomerase protein N-terminus |