Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01083 |
NCBI Accession ID | NC_000913.3 |
Organism | Escherichia coli str. K-12 substr. MG1655 |
Left | 1632890 |
Right | 1633003 |
Strand | + |
Nucleotide Sequence | ATGAACAGCATACTGATAATCACATCTCTCCTTATCATATTCAGCATTTTTAGTCATGCCCTAATAAAATTAGGGATTGGCATATCCAATAACCCAGACAAAACCGATGTATAA |
Sequence | MNSILIITSLLIIFSIFSHALIKLGIGISNNPDKTDV |
Source of smORF | Protein-level |
Function | integral component of membrane [GO:0016021]; plasma membrane [GO:0005886];INDUCTION: Expressed approximately equally in exponential and stationary phases (at protein level) Pubmed:29645342 |
Pubmed ID | 19121005 29645342 30837344 |
Domain | |
Functional Category | Gene Ontology/Expression based functional assignment |
Uniprot ID | P0DPO4 |
ORF Length (Amino Acid) | 37 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1632890 | 1633003 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
2 | 1434293 | 1434406 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
3 | 2537943 | 2538047 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
4 | 2653758 | 2653862 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01432.22 | 0.67 | 2 | 3470.5 | opposite-strand | Peptidase family M3 |
2 | PF12833.9 | 0.67 | 2 | 4344 | opposite-strand | Helix-turn-helix domain |
3 | PF00165.25 | 0.67 | 2 | 4344 | opposite-strand | Bacterial regulatory helix-turn-helix proteins, AraC family |
4 | PF02586.16 | 0.67 | 2 | 929.0 | same-strand | SOS response associated peptidase (SRAP) |
5 | PF00011.23 | 0.67 | 2 | 496.0 | opposite-strand | Hsp20/alpha crystallin family |
6 | PF02464.19 | 0.67 | 2 | 1136.5 | opposite-strand | Competence-damaged protein |
7 | PF00563.22 | 0.67 | 2 | 1669.5 | same-strand | EAL domain |
8 | PF04940.14 | 0.67 | 2 | 1669.5 | same-strand | Sensors of blue-light using FAD |