Result : EXP01083
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01083 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 1632890 |
| Right | 1633003 |
| Strand | + |
| Nucleotide Sequence | ATGAACAGCATACTGATAATCACATCTCTCCTTATCATATTCAGCATTTTTAGTCATGCCCTAATAAAATTAGGGATTGGCATATCCAATAACCCAGACAAAACCGATGTATAA |
| Sequence | MNSILIITSLLIIFSIFSHALIKLGIGISNNPDKTDV |
| Source of smORF | Protein-level |
| Function | integral component of membrane [GO:0016021]; plasma membrane [GO:0005886];INDUCTION: Expressed approximately equally in exponential and stationary phases (at protein level) Pubmed:29645342 |
| Pubmed ID | 19121005 29645342 30837344 |
| Domain | |
| Functional Category | Gene Ontology/Expression based functional assignment |
| Uniprot ID | P0DPO4 |
| ORF Length (Amino Acid) | 37 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1632890 | 1633003 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 1434293 | 1434406 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 2537943 | 2538047 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 4 | 2653758 | 2653862 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_016845.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01432.22 | 0.67 | 2 | 3470.5 | opposite-strand | Peptidase family M3 |
| 2 | PF12833.9 | 0.67 | 2 | 4344 | opposite-strand | Helix-turn-helix domain |
| 3 | PF00165.25 | 0.67 | 2 | 4344 | opposite-strand | Bacterial regulatory helix-turn-helix proteins, AraC family |
| 4 | PF02586.16 | 0.67 | 2 | 929.0 | same-strand | SOS response associated peptidase (SRAP) |
| 5 | PF00011.23 | 0.67 | 2 | 496.0 | opposite-strand | Hsp20/alpha crystallin family |
| 6 | PF02464.19 | 0.67 | 2 | 1136.5 | opposite-strand | Competence-damaged protein |
| 7 | PF00563.22 | 0.67 | 2 | 1669.5 | same-strand | EAL domain |
| 8 | PF04940.14 | 0.67 | 2 | 1669.5 | same-strand | Sensors of blue-light using FAD |
++ More..