ProsmORF-pred
Result : EXP01079
Protein Information
Information Type Description
Protein name EXP01079
NCBI Accession ID NC_000913.3
Organism Escherichia coli str. K-12 substr. MG1655
Left 2905557
Right 2905697
Strand +
Nucleotide Sequence ATGTCAGAAGAAAATAAAGAAAATGGATTTAATCATGTCAAAACATTCACCAAAATTATATTTATTTTTTCTGTATTAGTTTTTAATGATAACGAATATAAAATTACCGATGCCGCCGTCAATTTATTTATCCAGATTTAA
Sequence MSEENKENGFNHVKTFTKIIFIFSVLVFNDNEYKITDAAVNLFIQI
Source of smORF Protein-level
Function cellular response to cell envelope stress [GO:0036460];INDUCTION: In exponential phase (at protein level) Pubmed:19121005
Pubmed ID 19121005 29645342 30837344
Domain
Functional Category Gene Ontology/Expression based functional assignment
Uniprot ID C1P612
ORF Length (Amino Acid) 46
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 2
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 2905557 2905697 + NC_000913.3 Escherichia coli str. K-12 substr. MG1655
2 2864441 2864581 + NC_004337.2 Shigella flexneri 2a str. 301
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_000913.3
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF02913.21 1.0 2 3802.5 opposite-strand FAD linked oxidases, C-terminal domain
2 PF13394.8 1.0 2 139.0 opposite-strand 4Fe-4S single cluster domain
3 PF00113.24 1.0 2 1314.5 opposite-strand Enolase, C-terminal TIM barrel domain
4 PF03952.18 1.0 2 1314.5 opposite-strand Enolase, N-terminal domain
5 PF06418.16 1.0 2 2700.5 opposite-strand CTP synthase N-terminus
6 PF00117.30 1.0 2 2700.5 opposite-strand Glutamine amidotransferase class-I
7 PF03819.19 1.0 2 4565.5 opposite-strand MazG nucleotide pyrophosphohydrolase domain
++ More..