Result : EXP01075
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01075 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 1878773 |
| Right | 1878871 |
| Strand | + |
| Nucleotide Sequence | ATGCGAATCGGTATTATTTTTCCGGTTGTAATCTTCATTACAGCGGTCGTATTTTTAGCATGGTTTTTTATTGGCGGCTATGCTGCCCCGGGAGCATAA |
| Sequence | MRIGIIFPVVIFITAVVFLAWFFIGGYAAPGA |
| Source of smORF | Protein-level |
| Function | Found to be membrane localised by experiment. Pubmed:19121005 The ORF matches to the profile of NF033821. Profile Description: YoaK family small membrane protein. YoaK is a small protein (about 32 amino acids) found in E. coli (from which it is named), Salmonella, Klebsiella, Pantoea, and related taxa. It associates with the inner membrane. |
| Pubmed ID | 19121005 29645342 30837344 |
| Domain | CDD:411394 |
| Functional Category | Manually curated function from literature |
| Uniprot ID | C1P602 |
| ORF Length (Amino Acid) | 32 |
++ More..
| Conservation Analysis |
No. of Species: 52
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1878773 | 1878871 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 2055586 | 2055684 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 3 | 2480515 | 2480613 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 1966225 | 1966323 | - | NZ_LR134340.1 | Escherichia marmotae |
| 5 | 1811819 | 1811917 | + | NZ_AP014857.1 | Escherichia albertii |
| 6 | 1468327 | 1468425 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 7 | 3504737 | 3504835 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 8 | 2079657 | 2079755 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 9 | 1065818 | 1065916 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 10 | 1846757 | 1846855 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 11 | 695847 | 695945 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 12 | 1821227 | 1821325 | - | NC_015968.1 | Enterobacter soli |
| 13 | 1798530 | 1798628 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 14 | 3507826 | 3507924 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 15 | 1358481 | 1358579 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 16 | 1353516 | 1353614 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 17 | 718000 | 718098 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 18 | 1863327 | 1863425 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 19 | 1829158 | 1829256 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 20 | 606058 | 606156 | - | NZ_CP038469.1 | Citrobacter tructae |
| 21 | 3758456 | 3758554 | - | NZ_CP053416.1 | Salmonella bongori |
| 22 | 860046 | 860144 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 23 | 4318536 | 4318634 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 24 | 4741326 | 4741424 | - | NZ_CP033744.1 | Citrobacter freundii |
| 25 | 331843 | 331941 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 26 | 1649466 | 1649564 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 27 | 1726465 | 1726563 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 28 | 2886468 | 2886566 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 29 | 3483739 | 3483843 | + | NZ_CP050508.1 | Raoultella terrigena |
| 30 | 4984684 | 4984782 | + | NZ_CP040428.1 | Jejubacter calystegiae |
| 31 | 1969898 | 1969996 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 32 | 1252749 | 1252847 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 33 | 3959674 | 3959772 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 34 | 4647016 | 4647114 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 35 | 1749355 | 1749453 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 36 | 2653513 | 2653617 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 37 | 1378773 | 1378871 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 38 | 1989114 | 1989209 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 39 | 3025108 | 3025203 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 40 | 3397122 | 3397220 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 41 | 1273905 | 1274003 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 42 | 1788906 | 1789004 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 43 | 1298412 | 1298510 | + | NZ_LT906479.1 | Serratia ficaria |
| 44 | 719833 | 719931 | - | NZ_CP065640.1 | Serratia rubidaea |
| 45 | 2224123 | 2224221 | - | NZ_AP023184.1 | Buttiauxella agrestis |
| 46 | 2857598 | 2857690 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 47 | 2019795 | 2019893 | - | NZ_CP038853.1 | Pantoea vagans |
| 48 | 2031228 | 2031326 | - | NZ_CP045720.1 | Pantoea eucalypti |
| 49 | 2039215 | 2039313 | + | NZ_CP034148.1 | Pantoea agglomerans |
| 50 | 2302847 | 2302945 | - | NC_017554.1 | Pantoea ananatis PA13 |
| 51 | 512965 | 513063 | + | NZ_CP049115.1 | Pantoea stewartii |
| 52 | 2339291 | 2339392 | + | NZ_LN907827.1 | Erwinia gerundensis |
| 53 | 2574447 | 2574545 | + | NZ_CP026377.1 | Mixta gaviniae |
++ More..