Result : EXP01067
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01067 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 1995655 |
| Right | 1995831 |
| Strand | + |
| Nucleotide Sequence | ATGATAAAAATATTTATTGGTCATTATATTAACGTATTTTATAGCACTGCCGATATCACGCTCAAAAAACAACCACTGCTATTTTTAGCAAAGCTTATGGTATACTCCGCCGCCTTAACATTTTTCACCGCAAATTTTCATTGCAACATGACGAGGAAAATAAATGAGTACGCCTGA |
| Sequence | MIKIFIGHYINVFYSTADITLKKQPLLFLAKLMVYSAALTFFTANFHCNMTRKINEYA |
| Source of smORF | Protein-level |
| Function | INDUCTION: Expressed in both exponential and stationary phase; expression is higher in exponential phase (at protein level) Pubmed:29645342 |
| Pubmed ID | 19121005 29645342 30837344 |
| Domain | |
| Functional Category | Gene Ontology/Expression based functional assignment |
| Uniprot ID | P0DPP3 |
| ORF Length (Amino Acid) | 58 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1995655 | 1995831 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 1991937 | 1992113 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 2572163 | 2572339 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 2618063 | 2618239 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 1926534 | 1926710 | + | NZ_AP014857.1 | Escherichia albertii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03222.15 | 1.0 | 4 | 4763.0 | same-strand | Tryptophan/tyrosine permease family |
| 2 | PF03695.15 | 1.0 | 4 | 4035.5 | opposite-strand | Uncharacterised protein family (UPF0149) |
| 3 | PF02810.17 | 1.0 | 4 | 4035.5 | opposite-strand | SEC-C motif |
| 4 | PF01066.23 | 1.0 | 4 | 2838 | opposite-strand | CDP-alcohol phosphatidyltransferase |
| 5 | PF08459.13 | 1.0 | 4 | 949 | opposite-strand | UvrC RIbonuclease H-like domain |
| 6 | PF00633.25 | 1.0 | 4 | 949 | opposite-strand | Helix-hairpin-helix motif |
| 7 | PF01541.26 | 1.0 | 4 | 949 | opposite-strand | GIY-YIG catalytic domain |
| 8 | PF02151.21 | 1.0 | 4 | 949 | opposite-strand | UvrB/uvrC motif |
| 9 | PF14520.8 | 1.0 | 4 | 949 | opposite-strand | Helix-hairpin-helix domain |
| 10 | PF00072.26 | 1.0 | 4 | 296 | opposite-strand | Response regulator receiver domain |
| 11 | PF00196.21 | 1.0 | 4 | 296.0 | opposite-strand | Bacterial regulatory proteins, luxR family |
| 12 | PF10769.11 | 1.0 | 4 | -13 | same-strand | Protein of unknown function (DUF2594) |
| 13 | PF03472.17 | 1.0 | 4 | 279 | opposite-strand | Autoinducer binding domain |
| 14 | PF00005.29 | 1.0 | 4 | 1231 | opposite-strand | ABC transporter |
| 15 | PF02463.21 | 1.0 | 4 | 1231 | opposite-strand | RecF/RecN/SMC N terminal domain |
| 16 | PF13401.8 | 1.0 | 4 | 1231 | opposite-strand | AAA domain |
| 17 | PF00528.24 | 0.75 | 3 | 1979.5 | opposite-strand | Binding-protein-dependent transport system inner membrane component |
| 18 | PF00291.27 | 0.75 | 3 | 2662 | opposite-strand | Pyridoxal-phosphate dependent enzyme |
++ More..