Result : B2I7B1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
| NCBI Accession ID | CP001011.1 |
| Organism | Xylella fastidiosa (strain M23) |
| Left | 1774465 |
| Right | 1774731 |
| Strand | - |
| Nucleotide Sequence | ATGCCAAAACGCTCCCCGCCAGACACCTCCCCCGTTGCCCGCTTTGAACAGTCTCTTCAAGAATTGGAGCAACTGGTACAGAACATGGAAACCGGAGCACTGAGCTTGGAACAGTCCCTTGGCGCTTACGAACGCGGTATCGCCCTGTATCGTGAATGCCATCAAGCCCTGGAACAAGCGCAATTGCGCGTCCGGATATTGAGCGATCCAATGCACCCAGATGACGGTGAACCGTTTGATCCCAGCCTCGTGAGTACATCCCAGTGA |
| Sequence | MPKRSPPDTSPVARFEQSLQELEQLVQNMETGALSLEQSLGAYERGIALYRECHQALEQAQLRVRILSDPMHPDDGEPFDPSLVSTSQ |
| Source of smORF | Swiss-Prot |
| Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
| Pubmed ID | 20601474 |
| Domain | CDD:412547 |
| Functional Category | Others |
| Uniprot ID | B2I7B1 |
| ORF Length (Amino Acid) | 88 |
++ More..
| Conservation Analysis |
No. of Species: 49
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1758646 | 1758912 | - | NC_004556.1 | Xylella fastidiosa Temecula1 |
| 2 | 2019424 | 2019690 | - | NZ_CP053627.1 | Xylella taiwanensis |
| 3 | 2656883 | 2657143 | + | NZ_CP012900.1 | Stenotrophomonas acidaminiphila |
| 4 | 4678141 | 4678404 | + | NZ_CP043476.1 | Xanthomonas hyacinthi |
| 5 | 3299562 | 3299822 | + | NZ_CP037883.1 | Stenotrophomonas indicatrix |
| 6 | 3162297 | 3162557 | + | NZ_LS483377.1 | Stenotrophomonas maltophilia |
| 7 | 2744230 | 2744493 | + | NZ_CP033326.1 | Xanthomonas cucurbitae |
| 8 | 1479821 | 1480081 | - | NZ_LT853882.1 | Xanthomonas fragariae |
| 9 | 1076750 | 1077013 | + | NZ_CP018725.1 | Xanthomonas vesicatoria ATCC 35937 |
| 10 | 3267496 | 3267756 | + | NZ_CP048044.1 | Xanthomonas citri |
| 11 | 3147585 | 3147845 | + | NZ_CP072268.1 | Xanthomonas euvesicatoria pv. alfalfae |
| 12 | 1412647 | 1412907 | - | NZ_CP007810.1 | Xanthomonas oryzae pv. oryzicola |
| 13 | 2867899 | 2868165 | + | NZ_CP046570.1 | Xanthomonas albilineans |
| 14 | 3073314 | 3073574 | + | NZ_CP028127.1 | Xanthomonas vasicola pv. vasculorum |
| 15 | 1802614 | 1802877 | - | NZ_CP058243.1 | Xanthomonas campestris pv. raphani |
| 16 | 3614958 | 3615218 | + | NZ_CP060731.1 | Pseudoxanthomonas mexicana |
| 17 | 1737580 | 1737843 | + | NZ_CP016878.1 | Xanthomonas hortorum |
| 18 | 2034765 | 2035040 | - | NZ_CP023465.1 | Lysobacter capsici |
| 19 | 1291076 | 1291321 | - | NZ_CP046603.1 | Lysobacter soli |
| 20 | 2226421 | 2226681 | + | NC_016147.2 | Pseudoxanthomonas spadix BD-a59 |
| 21 | 2020902 | 2021177 | - | NZ_AP014940.1 | Lysobacter enzymogenes |
| 22 | 2797372 | 2797638 | - | NZ_CP060711.1 | Thermomonas brevis |
| 23 | 1375174 | 1375446 | - | NZ_CP029843.1 | Lysobacter maris |
| 24 | 1322862 | 1323125 | + | NZ_CP029556.1 | Lysobacter oculi |
| 25 | 3707992 | 3708267 | + | NZ_CP011131.1 | Lysobacter gummosus |
| 26 | 2131741 | 2132025 | - | NZ_CP011129.1 | Lysobacter antibioticus |
| 27 | 369011 | 369277 | + | NZ_CP042218.1 | Luteimonas granuli |
| 28 | 2014080 | 2014337 | + | NZ_CP014841.1 | Dyella thiooxydans |
| 29 | 1123476 | 1123733 | - | NC_020541.1 | Rhodanobacter denitrificans |
| 30 | 1625860 | 1626114 | + | NZ_CP071517.1 | Lysobacter arenosi |
| 31 | 2650848 | 2651117 | + | NZ_CP041242.1 | Lysobacter alkalisoli |
| 32 | 2612991 | 2613272 | - | NZ_CP060820.1 | Lysobacter solisilvae (ex Woo and Kim 2020) |
| 33 | 1368380 | 1368634 | - | NZ_AP018560.1 | Aerosticca soli |
| 34 | 2621446 | 2621718 | + | NZ_CP023406.1 | Luteimonas chenhongjianii |
| 35 | 1255230 | 1255490 | - | NZ_CP041046.1 | Luteibacter pinisoli |
| 36 | 2252318 | 2252572 | - | NZ_CP015249.1 | Dokdonella koreensis DS-123 |
| 37 | 3343081 | 3343335 | + | NZ_CP035704.1 | Pseudolysobacter antarcticus |
| 38 | 2796401 | 2796661 | - | NZ_CP017480.1 | Luteibacter rhizovicinus DSM 16549 |
| 39 | 770474 | 770698 | - | NC_017033.1 | Frateuria aurantia DSM 6220 |
| 40 | 2538697 | 2538939 | + | NZ_CP039268.1 | Thermochromatium tepidum ATCC 43061 |
| 41 | 4366993 | 4367238 | + | NC_018012.1 | Thiocystis violascens DSM 198 |
| 42 | 894001 | 894243 | - | NC_013851.1 | Allochromatium vinosum DSM 180 |
| 43 | 848474 | 848716 | - | NZ_CP047698.1 | Pseudomonas knackmussii |
| 44 | 987048 | 987290 | - | NZ_CP007031.1 | Marichromatium purpuratum 984 |
| 45 | 722438 | 722680 | - | NZ_AP014862.1 | Pseudomonas furukawaii |
| 46 | 3560038 | 3560292 | + | NZ_CP020931.1 | Marinobacter salarius |
| 47 | 4525312 | 4525554 | + | NC_002516.2 | Pseudomonas aeruginosa PAO1 |
| 48 | 5912524 | 5912766 | + | NZ_CP014158.1 | Pseudomonas citronellolis |
| 49 | 800490 | 800732 | - | NZ_CP013124.1 | Pseudomonas mendocina S5.2 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP012900.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00348.19 | 0.98 | 48 | -7.0 | same-strand | Polyprenyl synthetase |
| 2 | PF01171.22 | 0.76 | 37 | 33 | same-strand | PP-loop family |
| 3 | PF11734.10 | 0.76 | 37 | 33 | same-strand | TilS substrate C-terminal domain |
| 4 | PF09179.13 | 0.78 | 38 | 33.0 | same-strand | TilS substrate binding domain |
| 5 | PF09685.12 | 0.65 | 32 | 1347.0 | opposite-strand | Domain of unknown function (DUF4870) |
| 6 | PF19289.1 | 0.61 | 30 | 3049 | opposite-strand | PmbA/TldA metallopeptidase C-terminal domain |
| 7 | PF19290.1 | 0.61 | 30 | 3049 | opposite-strand | PmbA/TldA metallopeptidase central domain |
| 8 | PF01523.18 | 0.61 | 30 | 3049 | opposite-strand | PmbA/TldA metallopeptidase domain 1 |
++ More..