Result : EXP01062
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01062 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 1240260 |
| Right | 1240463 |
| Strand | + |
| Nucleotide Sequence | ATGGACGACAAACAATTGCAGGCTCAGGCTGCGTTCAGCAAAGCATCGCAACCGGCGATAGATGCTTCATTAAATTTAAGATTCAGCTTCCTCTTCAGCCACCCGTACGCCAATCTTCAACACTTCATTATCTTCTTTCTCGGCCACCGTCCAGATCATCCCGGCAAACTCTACCTGGTCACCGACAACCGGTGCCGCGCCTAA |
| Sequence | MDDKQLQAQAAFSKASQPAIDASLNLRFSFLFSHPYANLQHFIIFFLGHRPDHPGKLYLVTDNRCRA |
| Source of smORF | Protein-level |
| Function | INDUCTION: Expressed approximately equally in exponential and stationary phases (at protein level) Pubmed:29645342 |
| Pubmed ID | 19121005 29645342 30837344 |
| Domain | |
| Functional Category | Gene Ontology/Expression based functional assignment |
| Uniprot ID | P0DPO0 |
| ORF Length (Amino Acid) | 67 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1240260 | 1240463 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 1225761 | 1225961 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04293.15 | 1.0 | 2 | 3924.0 | opposite-strand | SpoVR like protein |
| 2 | PF01266.26 | 1.0 | 2 | 2296.0 | same-strand | FAD dependent oxidoreductase |
| 3 | PF01168.22 | 1.0 | 2 | 1216.0 | same-strand | Alanine racemase, N-terminal domain |
| 4 | PF00842.23 | 1.0 | 2 | 1216.0 | same-strand | Alanine racemase, C-terminal domain |
| 5 | PF00999.23 | 1.0 | 2 | -128.0 | opposite-strand | Sodium/hydrogen exchanger family |
| 6 | PF02080.23 | 1.0 | 2 | -128.0 | opposite-strand | TrkA-C domain |
| 7 | PF03471.19 | 1.0 | 2 | -128.0 | opposite-strand | Transporter associated domain |
| 8 | PF17676.3 | 1.0 | 2 | 1703.0 | opposite-strand | LD-carboxypeptidase C-terminal domain |
| 9 | PF02016.17 | 1.0 | 2 | 1703.0 | opposite-strand | LD-carboxypeptidase N-terminal domain |
| 10 | PF01464.22 | 1.0 | 2 | 2693.5 | same-strand | Transglycosylase SLT domain |
| 11 | PF07317.14 | 1.0 | 2 | 3330.5 | opposite-strand | Flagellar regulator YcgR |
| 12 | PF07238.16 | 1.0 | 2 | 3330.5 | opposite-strand | PilZ domain |
| 13 | PF04226.15 | 1.0 | 2 | 4265.5 | same-strand | Transglycosylase associated protein |
++ More..