Result : B2I5M3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein SlyX homolog |
| NCBI Accession ID | CP001011.1 |
| Organism | Xylella fastidiosa (strain M23) |
| Left | 1378793 |
| Right | 1379029 |
| Strand | - |
| Nucleotide Sequence | ATGCATGAAAAGCTACTGACACTGTGTGATTGTGCGTTTGAAGCCCGCCTAATTGAATTGGAGATGCGTGTTTCTTTCCAAGAACAAGCGTTGACTGAAATAAGCGAAGCCTTGGCAGAAACTCGGTTGATCGGGGCACGTAATGCTGAGTTGATGCGTCATTTGCTTGAGGAGTTGGGCAAGGTACGCAATACACTGTATGAGCATCCGATCGACGAACCACCTCCGCACTATTGA |
| Sequence | MHEKLLTLCDCAFEARLIELEMRVSFQEQALTEISEALAETRLIGARNAELMRHLLEELGKVRNTLYEHPIDEPPPHY |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01090. Profile Description: SlyX. hypothetical protein; Provisional |
| Pubmed ID | 20601474 |
| Domain | CDD:412736 |
| Functional Category | Others |
| Uniprot ID | B2I5M3 |
| ORF Length (Amino Acid) | 78 |
++ More..
| Conservation Analysis |
No. of Species: 20
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1369252 | 1369488 | - | NC_004556.1 | Xylella fastidiosa Temecula1 |
| 2 | 1769391 | 1769627 | - | NZ_CP053627.1 | Xylella taiwanensis |
| 3 | 1833908 | 1834144 | + | NZ_CP072268.1 | Xanthomonas euvesicatoria pv. alfalfae |
| 4 | 1831968 | 1832204 | + | NZ_CP048044.1 | Xanthomonas citri |
| 5 | 1811465 | 1811701 | + | NZ_CP028127.1 | Xanthomonas vasicola pv. vasculorum |
| 6 | 3100536 | 3100772 | - | NZ_CP058243.1 | Xanthomonas campestris pv. raphani |
| 7 | 1475195 | 1475431 | + | NZ_CP007810.1 | Xanthomonas oryzae pv. oryzicola |
| 8 | 1517062 | 1517298 | + | NZ_CP033326.1 | Xanthomonas cucurbitae |
| 9 | 1862139 | 1862375 | + | NZ_LT853882.1 | Xanthomonas fragariae |
| 10 | 4830722 | 4830958 | + | NZ_CP018725.1 | Xanthomonas vesicatoria ATCC 35937 |
| 11 | 262893 | 263129 | + | NZ_CP016878.1 | Xanthomonas hortorum |
| 12 | 1904390 | 1904593 | - | NZ_CP046570.1 | Xanthomonas albilineans |
| 13 | 2543927 | 2544169 | - | NZ_CP012900.1 | Stenotrophomonas acidaminiphila |
| 14 | 2863275 | 2863517 | - | NZ_LS483377.1 | Stenotrophomonas maltophilia |
| 15 | 2978325 | 2978564 | - | NZ_CP037883.1 | Stenotrophomonas indicatrix |
| 16 | 2524560 | 2524796 | + | NZ_CP060731.1 | Pseudoxanthomonas mexicana |
| 17 | 1557869 | 1558105 | + | NC_016147.2 | Pseudoxanthomonas spadix BD-a59 |
| 18 | 167208 | 167399 | - | NZ_CP060820.1 | Lysobacter solisilvae (ex Woo and Kim 2020) |
| 19 | 825675 | 825866 | + | NZ_CP071517.1 | Lysobacter arenosi |
| 20 | 1720163 | 1720402 | + | NZ_CP046603.1 | Lysobacter soli |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP072268.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07690.18 | 0.6 | 12 | 3232.0 | same-strand | Major Facilitator Superfamily |
| 2 | PF09831.11 | 0.9 | 18 | 19.0 | same-strand | Uncharacterized protein conserved in bacteria (DUF2058) |
| 3 | PF03721.16 | 0.9 | 18 | -7.0 | same-strand | UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain |
| 4 | PF00984.21 | 0.9 | 18 | -7.0 | same-strand | UDP-glucose/GDP-mannose dehydrogenase family, central domain |
| 5 | PF03720.17 | 0.9 | 18 | -7.0 | same-strand | UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain |
| 6 | PF00254.30 | 1.0 | 20 | 1368 | same-strand | FKBP-type peptidyl-prolyl cis-trans isomerase |
| 7 | PF01346.20 | 1.0 | 20 | 1368 | same-strand | Domain amino terminal to FKBP-type peptidyl-prolyl isomerase |
| 8 | PF00255.21 | 0.85 | 17 | 2429 | same-strand | Glutathione peroxidase |
| 9 | PF00392.23 | 0.85 | 17 | 3372 | opposite-strand | Bacterial regulatory proteins, gntR family |
++ More..