Result : EXP01024
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01024 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 1673608 |
| Right | 1673709 |
| Strand | - |
| Nucleotide Sequence | ATGGACAATTTGTTCAGGACGTTATTTTCTACATTTACCCATCTTCGTACCTCATCCACTATCTTGCTCGTAGGTGAGCAGCACTGGCGCAACGCGCTTTAG |
| Sequence | MDNLFRTLFSTFTHLRTSSTILLVGEQHWRNAL |
| Source of smORF | Protein-level |
| Function | INDUCTION: Expressed at high levels equally in exponential and stationary phase in rich medium (at protein level) Pubmed:30837344 |
| Pubmed ID | 19121005 29645342 30837344 |
| Domain | |
| Functional Category | Gene Ontology/Expression based functional assignment |
| Uniprot ID | P0DSF5 |
| ORF Length (Amino Acid) | 33 |
++ More..
| Conservation Analysis |
No. of Species: 41
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2273546 | 2273647 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 1673608 | 1673709 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 1648246 | 1648347 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 2183605 | 2183706 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 5 | 2135172 | 2135273 | + | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 1617056 | 1617157 | - | NZ_AP014857.1 | Escherichia albertii |
| 7 | 3281234 | 3281335 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 8 | 3706880 | 3706981 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 9 | 1551926 | 1552030 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 10 | 1560030 | 1560131 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 11 | 53548 | 53649 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 12 | 27921 | 28022 | + | NZ_CP033744.1 | Citrobacter freundii |
| 13 | 993142 | 993243 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 14 | 865453 | 865554 | + | NZ_CP038469.1 | Citrobacter tructae |
| 15 | 1639904 | 1640002 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 16 | 2918723 | 2918821 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 17 | 103022 | 103123 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 18 | 1565550 | 1565651 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 19 | 3956900 | 3957001 | + | NZ_CP053416.1 | Salmonella bongori |
| 20 | 2086991 | 2087092 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 21 | 1383014 | 1383115 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 22 | 2038571 | 2038672 | + | NC_015968.1 | Enterobacter soli |
| 23 | 1290094 | 1290195 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 24 | 467350 | 467451 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 25 | 2302697 | 2302798 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 26 | 2598759 | 2598857 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 27 | 2015261 | 2015362 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 28 | 2072120 | 2072221 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 29 | 2090483 | 2090584 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 30 | 1802480 | 1802584 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 31 | 2259400 | 2259504 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 32 | 2195789 | 2195893 | - | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 33 | 2682776 | 2682874 | - | NZ_CP023525.1 | Cedecea neteri |
| 34 | 2390867 | 2390965 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 35 | 3928610 | 3928705 | - | NZ_CP042941.1 | Atlantibacter hermannii |
| 36 | 1184694 | 1184798 | + | NZ_CP027107.1 | Cronobacter sakazakii |
| 37 | 2371803 | 2371901 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 38 | 2474585 | 2474689 | - | NZ_AP023184.1 | Buttiauxella agrestis |
| 39 | 2451788 | 2451886 | - | NZ_LR134201.1 | Cedecea lapagei |
| 40 | 864786 | 864884 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 41 | 2230388 | 2230486 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 42 | 2936499 | 2936597 | - | NZ_CP014007.2 | Kosakonia oryzae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13365.8 | 0.98 | 40 | 857 | opposite-strand | Trypsin-like peptidase domain |
| 2 | PF00893.21 | 1.0 | 41 | 299.0 | same-strand | Small Multidrug Resistance protein |
| 3 | PF01594.18 | 0.88 | 36 | 204 | opposite-strand | AI-2E family transporter |
++ More..