Result : EXP01018
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01018 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 1622741 |
| Right | 1622845 |
| Strand | + |
| Nucleotide Sequence | ATGAACGGAGATAATCCCTCACCTAACCGGCCCCTTGTTACAGTTGTGTACAAGGGGCCTGATTTTTATGACGGCGAAAAAAAACCGCCAGTAAACCGGCGGTGA |
| Sequence | MNGDNPSPNRPLVTVVYKGPDFYDGEKKPPVNRR |
| Source of smORF | Protein-level |
| Function | INDUCTION: Expressed in both exponential and stationary phase in rich medium; expression is higher in exponential phase (at protein level) Pubmed:30837344 |
| Pubmed ID | 19121005 29645342 30837344 |
| Domain | |
| Functional Category | Gene Ontology/Expression based functional assignment |
| Uniprot ID | P0DSF3 |
| ORF Length (Amino Acid) | 34 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2148772 | 2148876 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 1622741 | 1622845 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 1587851 | 1587955 | + | NZ_AP014857.1 | Escherichia albertii |
| 4 | 3740500 | 3740607 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 5 | 1593954 | 1594064 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00892.22 | 0.75 | 3 | 1733.5 | opposite-strand | EamA-like transporter family |
| 2 | PF07690.18 | 0.75 | 3 | 333.0 | same-strand | Major Facilitator Superfamily |
| 3 | PF12833.9 | 0.75 | 3 | 1493.5 | same-strand | Helix-turn-helix domain |
| 4 | PF01432.22 | 1.0 | 4 | 2232 | opposite-strand | Peptidase family M3 |
| 5 | PF00106.27 | 1.0 | 4 | 4413 | same-strand | short chain dehydrogenase |
| 6 | PF13561.8 | 1.0 | 4 | 4413 | same-strand | Enoyl-(Acyl carrier protein) reductase |
| 7 | PF08659.12 | 1.0 | 4 | 4413 | same-strand | KR domain |
++ More..