Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01018 |
NCBI Accession ID | NC_000913.3 |
Organism | Escherichia coli str. K-12 substr. MG1655 |
Left | 1622741 |
Right | 1622845 |
Strand | + |
Nucleotide Sequence | ATGAACGGAGATAATCCCTCACCTAACCGGCCCCTTGTTACAGTTGTGTACAAGGGGCCTGATTTTTATGACGGCGAAAAAAAACCGCCAGTAAACCGGCGGTGA |
Sequence | MNGDNPSPNRPLVTVVYKGPDFYDGEKKPPVNRR |
Source of smORF | Protein-level |
Function | INDUCTION: Expressed in both exponential and stationary phase in rich medium; expression is higher in exponential phase (at protein level) Pubmed:30837344 |
Pubmed ID | 19121005 29645342 30837344 |
Domain | |
Functional Category | Gene Ontology/Expression based functional assignment |
Uniprot ID | P0DSF3 |
ORF Length (Amino Acid) | 34 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2148772 | 2148876 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
2 | 1622741 | 1622845 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
3 | 1587851 | 1587955 | + | NZ_AP014857.1 | Escherichia albertii |
4 | 3740500 | 3740607 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
5 | 1593954 | 1594064 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00892.22 | 0.75 | 3 | 1733.5 | opposite-strand | EamA-like transporter family |
2 | PF07690.18 | 0.75 | 3 | 333.0 | same-strand | Major Facilitator Superfamily |
3 | PF12833.9 | 0.75 | 3 | 1493.5 | same-strand | Helix-turn-helix domain |
4 | PF01432.22 | 1.0 | 4 | 2232 | opposite-strand | Peptidase family M3 |
5 | PF00106.27 | 1.0 | 4 | 4413 | same-strand | short chain dehydrogenase |
6 | PF13561.8 | 1.0 | 4 | 4413 | same-strand | Enoyl-(Acyl carrier protein) reductase |
7 | PF08659.12 | 1.0 | 4 | 4413 | same-strand | KR domain |