Result : EXP01013

Protein Information

• Protein name: EXP01013
• NCBI Accession ID: NC_000913.3
• Organism: Escherichia coli str. K-12 substr. MG1655
• Left: 4536597
• Right: 4536695
• Strand: +
• Nucleotide Sequence: ATGAATAAACTCCCCGCTCACCTTTCGCGCCAAAACTGCAAAATTGCTTCTACAAATCTGTCAGAAATAATCCCCCGACGGGCTGCAGTGCTGAAATGA
• Sequence: MNKLPAHLSRQNCKIASTNLSEIIPRRAAVLK
• Source of smORF: Protein-level
• Function: INDUCTION: Expressed in both exponential and stationary phase in rich medium; expression is considerably higher during exponential phase (at protein level) Pubmed:30837344
• Pubmed ID: 19121005 29645342 30837344
• Functional Category: Gene Ontology/Expression based functional assignment
• Uniprot ID: P0DSI0
• ORF Length (Amino Acid): 32

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	4536597	4536695	+	NC_000913.3	Escherichia coli str. K-12 substr. MG1655
2	4388520	4388618	-	NC_004337.2	Shigella flexneri 2a str. 301
3	5391641	5391730	+	NC_002695.2	Escherichia coli O157:H7 str. Sakai

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_000913.3

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF13964.8	1.0	2	964	opposite-strand	Kelch motif
2	PF13418.8	1.0	2	964	opposite-strand	Galactose oxidase, central domain
3	PF07646.17	1.0	2	964	opposite-strand	Kelch motif
4	PF01344.27	1.0	2	964	opposite-strand	Kelch motif
5	PF13854.8	1.0	2	964	opposite-strand	Kelch motif
6	PF06178.15	1.0	2	2090	opposite-strand	Oligogalacturonate-specific porin protein (KdgM)
7	PF00589.24	1.0	2	4262	same-strand	Phage integrase family