Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01013 |
NCBI Accession ID | NC_000913.3 |
Organism | Escherichia coli str. K-12 substr. MG1655 |
Left | 4536597 |
Right | 4536695 |
Strand | + |
Nucleotide Sequence | ATGAATAAACTCCCCGCTCACCTTTCGCGCCAAAACTGCAAAATTGCTTCTACAAATCTGTCAGAAATAATCCCCCGACGGGCTGCAGTGCTGAAATGA |
Sequence | MNKLPAHLSRQNCKIASTNLSEIIPRRAAVLK |
Source of smORF | Protein-level |
Function | INDUCTION: Expressed in both exponential and stationary phase in rich medium; expression is considerably higher during exponential phase (at protein level) Pubmed:30837344 |
Pubmed ID | 19121005 29645342 30837344 |
Domain | |
Functional Category | Gene Ontology/Expression based functional assignment |
Uniprot ID | P0DSI0 |
ORF Length (Amino Acid) | 32 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 4536597 | 4536695 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
2 | 4388520 | 4388618 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
3 | 5391641 | 5391730 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13964.8 | 1.0 | 2 | 964 | opposite-strand | Kelch motif |
2 | PF13418.8 | 1.0 | 2 | 964 | opposite-strand | Galactose oxidase, central domain |
3 | PF07646.17 | 1.0 | 2 | 964 | opposite-strand | Kelch motif |
4 | PF01344.27 | 1.0 | 2 | 964 | opposite-strand | Kelch motif |
5 | PF13854.8 | 1.0 | 2 | 964 | opposite-strand | Kelch motif |
6 | PF06178.15 | 1.0 | 2 | 2090 | opposite-strand | Oligogalacturonate-specific porin protein (KdgM) |
7 | PF00589.24 | 1.0 | 2 | 4262 | same-strand | Phage integrase family |