Result : EXP01007
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01007 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 1344647 |
| Right | 1344775 |
| Strand | + |
| Nucleotide Sequence | ATGCAAAAATTGCCGCTAAAAGAGAAGTGTTTAACAGCAACGGCTAATTATCATCCAGGAATACGATATATAATGACGGGATATAGCGCTAAGTATATATATTCATCTACTTATGCGCGCTTCAGATAG |
| Sequence | MQKLPLKEKCLTATANYHPGIRYIMTGYSAKYIYSSTYARFR |
| Source of smORF | Protein-level |
| Function | INDUCTION: Expressed in both exponential and stationary phase in rich medium; expression is higher in exponential phase (at protein level) Pubmed:30837344 |
| Pubmed ID | 19121005 29645342 30837344 |
| Domain | |
| Functional Category | Gene Ontology/Expression based functional assignment |
| Uniprot ID | P0DSF0 |
| ORF Length (Amino Acid) | 42 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1344647 | 1344775 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 1338931 | 1339059 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 1845490 | 1845618 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 2350912 | 2351040 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 5 | 2391840 | 2391968 | - | NZ_LR134340.1 | Escherichia marmotae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00215.26 | 1.0 | 4 | 1989 | same-strand | Orotidine 5'-phosphate decarboxylase / HUMPS family |
| 2 | PF01253.24 | 1.0 | 4 | 1663 | same-strand | Translation initiation factor SUI1 |
| 3 | PF05433.17 | 0.75 | 3 | 1319.0 | opposite-strand | Glycine zipper 2TM domain |
| 4 | PF13441.8 | 0.75 | 3 | 1319.0 | opposite-strand | YMGG-like Gly-zipper |
| 5 | PF13488.8 | 0.75 | 3 | 1319.0 | opposite-strand | Glycine zipper |
| 6 | PF00455.24 | 1.0 | 4 | 301 | opposite-strand | DeoR C terminal sensor domain |
| 7 | PF08220.14 | 1.0 | 4 | 301 | opposite-strand | DeoR-like helix-turn-helix domain |
| 8 | PF00563.22 | 1.0 | 4 | -18 | opposite-strand | EAL domain |
| 9 | PF00990.23 | 0.75 | 3 | -18.0 | opposite-strand | Diguanylate cyclase, GGDEF domain |
| 10 | PF00773.21 | 0.75 | 3 | 2202.5 | opposite-strand | RNB domain |
| 11 | PF08206.13 | 0.75 | 3 | 2202.5 | opposite-strand | Ribonuclease B OB domain |
| 12 | PF00575.25 | 0.75 | 3 | 2202.5 | opposite-strand | S1 RNA binding domain |
| 13 | PF17876.3 | 0.75 | 3 | 2202.5 | opposite-strand | Cold shock domain |
++ More..