Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01003 |
NCBI Accession ID | NC_011916.1 |
Organism | Caulobacter vibrioides NA1000 |
Left | 2321655 |
Right | 2321942 |
Strand | - |
Nucleotide Sequence | ATGACCACCCCGATCCAAGACACCATCCTGTCCCAACTGGCGGCCTTGCCCGAAGGCAAGTCGATCGACCCTATGAACGTCGCCAAGGCGATCCAGCCCGAGCGCTGGCAGCAGCTGCTGGGCCATGTGCGCACCAACGCCATCGAACTGGCCCGTGAAGGCAAGGTGGTGATCCTGCGCCATAACAAGCCGACCAATCCCGAGAAGTTCCGCGGCGTCTATCGCATCCGCCTGCGCCTGGAAGGCGACCCGACCAGCTTTGAGGAAACGGCCGGCGACGAAGAATAG |
Sequence | MTTPIQDTILSQLAALPEGKSIDPMNVAKAIQPERWQQLLGHVRTNAIELAREGKVVILRHNKPTNPEKFRGVYRIRLRLEGDPTSFEETAGDEE |
Source of smORF | Protein-level |
Function | The ORF matches to the profile of pfam11625. Profile Description: Protein of unknown function (DUF3253). This bacterial family of proteins has no known function. |
Pubmed ID | 25078267 |
Domain | CDD:402979 |
Functional Category | Conserved domain based functional assignment |
Uniprot ID | |
ORF Length (Amino Acid) | 95 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2321655 | 2321942 | - | NC_011916.1 | Caulobacter vibrioides NA1000 |
2 | 1445197 | 1445487 | + | NZ_CP027850.1 | Caulobacter segnis |
3 | 1539972 | 1540268 | + | NZ_CP048815.1 | Caulobacter rhizosphaerae |
4 | 2499586 | 2499888 | - | NZ_CP013002.1 | Caulobacter henricii |
5 | 2925598 | 2925900 | + | NZ_CP026100.1 | Caulobacter flavus |
6 | 1608839 | 1609081 | + | NZ_CP024201.1 | Caulobacter mirabilis |
7 | 1798249 | 1798497 | - | NZ_CP029479.1 | Phenylobacterium parvum |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02812.20 | 0.86 | 6 | 2607.5 | same-strand | Glu/Leu/Phe/Val dehydrogenase, dimerisation domain |
2 | PF12146.10 | 0.86 | 6 | 1440.5 | same-strand | Serine aminopeptidase, S33 |
3 | PF12697.9 | 0.86 | 6 | 1440.5 | same-strand | Alpha/beta hydrolase family |
4 | PF03167.21 | 0.86 | 6 | 843.0 | same-strand | Uracil DNA glycosylase superfamily |
5 | PF13417.8 | 0.86 | 6 | 210 | same-strand | Glutathione S-transferase, N-terminal domain |
6 | PF13409.8 | 0.86 | 6 | 210 | same-strand | Glutathione S-transferase, N-terminal domain |
7 | PF02798.22 | 0.86 | 6 | 210 | same-strand | Glutathione S-transferase, N-terminal domain |
8 | PF03061.24 | 0.86 | 6 | 108.0 | opposite-strand | Thioesterase superfamily |
9 | PF00043.27 | 0.86 | 6 | 676.0 | same-strand | Glutathione S-transferase, C-terminal domain |
10 | PF13410.8 | 0.71 | 5 | 672 | same-strand | Glutathione S-transferase, C-terminal domain |