Result : EXP01003
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01003 |
| NCBI Accession ID | NC_011916.1 |
| Organism | Caulobacter vibrioides NA1000 |
| Left | 2321655 |
| Right | 2321942 |
| Strand | - |
| Nucleotide Sequence | ATGACCACCCCGATCCAAGACACCATCCTGTCCCAACTGGCGGCCTTGCCCGAAGGCAAGTCGATCGACCCTATGAACGTCGCCAAGGCGATCCAGCCCGAGCGCTGGCAGCAGCTGCTGGGCCATGTGCGCACCAACGCCATCGAACTGGCCCGTGAAGGCAAGGTGGTGATCCTGCGCCATAACAAGCCGACCAATCCCGAGAAGTTCCGCGGCGTCTATCGCATCCGCCTGCGCCTGGAAGGCGACCCGACCAGCTTTGAGGAAACGGCCGGCGACGAAGAATAG |
| Sequence | MTTPIQDTILSQLAALPEGKSIDPMNVAKAIQPERWQQLLGHVRTNAIELAREGKVVILRHNKPTNPEKFRGVYRIRLRLEGDPTSFEETAGDEE |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of pfam11625. Profile Description: Protein of unknown function (DUF3253). This bacterial family of proteins has no known function. |
| Pubmed ID | 25078267 |
| Domain | CDD:402979 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2321655 | 2321942 | - | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 2 | 1445197 | 1445487 | + | NZ_CP027850.1 | Caulobacter segnis |
| 3 | 1539972 | 1540268 | + | NZ_CP048815.1 | Caulobacter rhizosphaerae |
| 4 | 2499586 | 2499888 | - | NZ_CP013002.1 | Caulobacter henricii |
| 5 | 2925598 | 2925900 | + | NZ_CP026100.1 | Caulobacter flavus |
| 6 | 1608839 | 1609081 | + | NZ_CP024201.1 | Caulobacter mirabilis |
| 7 | 1798249 | 1798497 | - | NZ_CP029479.1 | Phenylobacterium parvum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011916.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02812.20 | 0.86 | 6 | 2607.5 | same-strand | Glu/Leu/Phe/Val dehydrogenase, dimerisation domain |
| 2 | PF12146.10 | 0.86 | 6 | 1440.5 | same-strand | Serine aminopeptidase, S33 |
| 3 | PF12697.9 | 0.86 | 6 | 1440.5 | same-strand | Alpha/beta hydrolase family |
| 4 | PF03167.21 | 0.86 | 6 | 843.0 | same-strand | Uracil DNA glycosylase superfamily |
| 5 | PF13417.8 | 0.86 | 6 | 210 | same-strand | Glutathione S-transferase, N-terminal domain |
| 6 | PF13409.8 | 0.86 | 6 | 210 | same-strand | Glutathione S-transferase, N-terminal domain |
| 7 | PF02798.22 | 0.86 | 6 | 210 | same-strand | Glutathione S-transferase, N-terminal domain |
| 8 | PF03061.24 | 0.86 | 6 | 108.0 | opposite-strand | Thioesterase superfamily |
| 9 | PF00043.27 | 0.86 | 6 | 676.0 | same-strand | Glutathione S-transferase, C-terminal domain |
| 10 | PF13410.8 | 0.71 | 5 | 672 | same-strand | Glutathione S-transferase, C-terminal domain |
++ More..