Result : EXP01002
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01002 |
| NCBI Accession ID | NC_011916.1 |
| Organism | Caulobacter vibrioides NA1000 |
| Left | 2674604 |
| Right | 2674744 |
| Strand | + |
| Nucleotide Sequence | ATGAAGCGTCCTGCGTCCTTCGAGGCTCGCCTTCGGCTCACACCTCAGGATGAGGTTTTCAGCAGCAACGTTCCTCATCCTGAGGCGCCCGCAAAGCGGGCCTCGAAGGACGCAGGGCGCCTGCCCGAGATTGAACAATGA |
| Sequence | MKRPASFEARLRLTPQDEVFSSNVPHPEAPAKRASKDAGRLPEIEQ |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 25078267 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 46 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2674604 | 2674744 | + | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 2 | 4337794 | 4337934 | + | NZ_CP048815.1 | Caulobacter rhizosphaerae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011916.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03652.17 | 1.0 | 2 | 2089.0 | same-strand | Holliday junction resolvase |
| 2 | PF02729.23 | 1.0 | 2 | -3.0 | same-strand | Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain |
| 3 | PF00185.26 | 1.0 | 2 | -3.0 | same-strand | Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain |
| 4 | PF01979.22 | 1.0 | 2 | -3.0 | same-strand | Amidohydrolase family |
| 5 | PF02660.17 | 1.0 | 2 | 3739.5 | same-strand | Glycerol-3-phosphate acyltransferase |
| 6 | PF08242.14 | 1.0 | 2 | 3678.0 | both-strands | Methyltransferase domain |
| 7 | PF08241.14 | 1.0 | 2 | 3678.0 | both-strands | Methyltransferase domain |
| 8 | PF13649.8 | 1.0 | 2 | 3678.0 | both-strands | Methyltransferase domain |
++ More..