Result : B2HCT9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L30 |
| NCBI Accession ID | CP000854.1 |
| Organism | Mycobacterium marinum (strain ATCC BAA-535 / M) |
| Left | 1277282 |
| Right | 1277500 |
| Strand | + |
| Nucleotide Sequence | ATGAGTGAAGCAACCAATCAGCTCAAGATCACCCAGGTGCGCAGCACCATCGGGGCGCGCTGGAAGCAGCGCGAGAGCCTGCGCACCCTGGGCTTGCGCCGGATCCGCCACACGGTGGTCCGCGACGACAACGCGCAGACCCGCGGGCTGATCGCGGTGGTGCGCCACCTCGTCGAGGTGGAGCCCGCCCAGAATGGCACCGGAGGTAAGGCACAGTGA |
| Sequence | MSEATNQLKITQVRSTIGARWKQRESLRTLGLRRIRHTVVRDDNAQTRGLIAVVRHLVEVEPAQNGTGGKAQ |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00203. Profile Description: N/A. This family includes prokaryotic L30 and eukaryotic L7. |
| Pubmed ID | 18403782 |
| Domain | CDD:412218 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B2HCT9 |
| ORF Length (Amino Acid) | 72 |
++ More..
| Conservation Analysis |
No. of Species: 140
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1300510 | 1300728 | + | NZ_AP018410.1 | Mycobacterium pseudoshottsii JCM 15466 |
| 2 | 2693192 | 2693410 | + | NZ_CP058277.1 | Mycobacterium marinum |
| 3 | 2737651 | 2737869 | + | NZ_AP022572.1 | Mycobacterium shottsii |
| 4 | 1007280 | 1007495 | + | NZ_LR130759.1 | Mycobacterium basiliense |
| 5 | 4764816 | 4764998 | + | NZ_AP022573.1 | Mycobacterium saskatchewanense |
| 6 | 814993 | 815190 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 7 | 830185 | 830382 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 8 | 3670134 | 3670310 | - | NZ_AP022581.1 | Mycobacterium lacus |
| 9 | 2981697 | 2981912 | - | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 10 | 3981543 | 3981749 | - | NZ_AP024310.1 | Mycobacterium heckeshornense |
| 11 | 777683 | 777859 | + | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
| 12 | 4373666 | 4373857 | - | NZ_CP009360.4 | Mycobacterium avium subsp. hominissuis |
| 13 | 3470600 | 3470791 | - | NZ_AP022590.1 | Mycobacterium mantenii |
| 14 | 2730459 | 2730650 | + | NZ_AP022583.1 | Mycobacterium noviomagense |
| 15 | 971398 | 971598 | + | NZ_AP018164.1 | Mycobacterium shigaense |
| 16 | 2175333 | 2175548 | - | NZ_CP029543.1 | Mycobacterium leprae |
| 17 | 4320063 | 4320248 | + | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 18 | 1698065 | 1698253 | - | NZ_AP022568.1 | Mycobacterium simiae |
| 19 | 3317516 | 3317701 | - | NZ_AP022614.1 | Mycobacterium parmense |
| 20 | 5202444 | 5202629 | + | NZ_AP022582.1 | Mycobacterium seoulense |
| 21 | 4500605 | 4500826 | + | NZ_AP022569.1 | Mycobacterium cookii |
| 22 | 4426501 | 4426686 | - | NZ_CP023147.1 | Mycobacterium marseillense |
| 23 | 4547852 | 4548037 | - | NC_016946.1 | Mycobacterium intracellulare ATCC 13950 |
| 24 | 4681644 | 4681829 | - | NC_016948.1 | Mycobacterium paraintracellulare |
| 25 | 1195767 | 1195949 | - | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 26 | 1231305 | 1231493 | + | NZ_CP025546.1 | Mycobacterium paragordonae |
| 27 | 5002788 | 5002970 | + | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 28 | 553456 | 553635 | - | NZ_AP022606.1 | Mycobacterium branderi |
| 29 | 2686410 | 2686592 | - | NZ_AP022576.1 | Mycobacterium florentinum |
| 30 | 3972186 | 3972371 | - | NZ_LR134355.1 | Mycolicibacterium chitae |
| 31 | 2926458 | 2926640 | - | NZ_AP022587.1 | Mycobacterium stomatepiae |
| 32 | 3554035 | 3554217 | - | NZ_CP010271.1 | Mycobacteroides saopaulense |
| 33 | 3897971 | 3898153 | - | NZ_CP007220.1 | Mycobacteroides chelonae CCUG 47445 |
| 34 | 3912234 | 3912416 | - | NZ_AP018165.1 | [Mycobacterium] stephanolepidis |
| 35 | 4358735 | 4358917 | - | NZ_CP011530.1 | Mycobacteroides immunogenum |
| 36 | 3857733 | 3857915 | - | NZ_CP014955.1 | Mycobacteroides abscessus |
| 37 | 2484749 | 2484928 | + | NZ_AP022588.1 | Mycolicibacterium sediminis |
| 38 | 642794 | 642976 | + | NZ_AP022613.1 | Mycobacterium conspicuum |
| 39 | 1098884 | 1099063 | - | NZ_AP022599.1 | Mycolicibacterium pulveris |
| 40 | 3617892 | 3618074 | - | NZ_CP024633.1 | Mycobacteroides salmoniphilum |
| 41 | 2397671 | 2397865 | - | NZ_AP022593.1 | Mycolicibacterium arabiense |
| 42 | 6407618 | 6407803 | - | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 43 | 1504621 | 1504806 | + | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 44 | 5850771 | 5850953 | - | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
| 45 | 1422711 | 1422893 | + | NZ_AP022618.1 | Mycolicibacterium insubricum |
| 46 | 3991120 | 3991302 | - | NZ_AP022612.1 | Mycolicibacterium confluentis |
| 47 | 4048472 | 4048651 | + | NZ_LS483468.1 | Rhodococcus coprophilus |
| 48 | 4111107 | 4111286 | - | NZ_CP022208.1 | Rhodococcus pyridinivorans |
| 49 | 2194640 | 2194822 | - | NZ_AP022603.1 | Mycolicibacterium fallax |
| 50 | 3308526 | 3308708 | + | NZ_AP022600.1 | Mycolicibacterium tokaiense |
| 51 | 3773015 | 3773194 | - | NZ_LT906450.1 | Rhodococcus rhodochrous |
| 52 | 654918 | 655100 | + | NZ_CP016076.1 | Actinoalloteichus fjordicus |
| 53 | 632746 | 632928 | + | NZ_CP022521.1 | Actinoalloteichus hoggarensis |
| 54 | 523401 | 523580 | + | NC_015564.1 | Hoyosella subflava DQS3-9A1 |
| 55 | 762093 | 762278 | + | NC_022116.1 | Amycolatopsis mediterranei RB |
| 56 | 3976474 | 3976653 | - | NZ_CP027793.1 | Rhodococcus hoagii |
| 57 | 2969290 | 2969469 | - | NZ_CP048813.1 | Rhodococcus triatomae |
| 58 | 245341 | 245520 | - | NZ_CP015235.1 | Rhodococcus fascians D188 |
| 59 | 10397600 | 10397785 | - | NZ_CP034550.1 | Saccharothrix syringae |
| 60 | 3502910 | 3503095 | + | NZ_CP016793.1 | Lentzea guizhouensis |
| 61 | 7738452 | 7738637 | - | NC_013093.1 | Actinosynnema mirum DSM 43827 |
| 62 | 7582108 | 7582293 | - | NZ_CP023445.1 | Actinosynnema pretiosum |
| 63 | 1994621 | 1994800 | + | NZ_AP023172.1 | Rhodococcus qingshengii |
| 64 | 8746965 | 8747150 | - | NC_019673.1 | Saccharothrix espanaensis DSM 44229 |
| 65 | 7233899 | 7234084 | + | NZ_CP015163.1 | Amycolatopsis albispora |
| 66 | 3418455 | 3418637 | + | NZ_LR134477.1 | Actinomyces viscosus |
| 67 | 2210334 | 2210552 | - | NZ_CP025227.1 | Actinomyces wuliandei |
| 68 | 1732240 | 1732443 | - | NZ_CP020468.1 | Actinomyces gaoshouyii |
| 69 | 572241 | 572444 | + | NZ_CP053642.1 | Actinomyces marmotae |
| 70 | 1817934 | 1818116 | + | NZ_CP040635.1 | Acidipropionibacterium jensenii |
| 71 | 2160321 | 2160506 | - | NC_008148.1 | Rubrobacter xylanophilus DSM 9941 |
| 72 | 1900164 | 1900352 | - | NC_010168.1 | Renibacterium salmoninarum ATCC 33209 |
| 73 | 2514425 | 2514613 | - | NZ_LR131272.1 | Arthrobacter agilis |
| 74 | 315212 | 315406 | - | NZ_CP018863.1 | Arthrobacter crystallopoietes |
| 75 | 1642796 | 1642981 | + | NZ_CP034248.1 | Paenibacillus lentus |
| 76 | 1283049 | 1283231 | + | NC_013947.1 | Stackebrandtia nassauensis DSM 44728 |
| 77 | 2502050 | 2502229 | + | NZ_LN849456.1 | Devriesea agamarum |
| 78 | 623885 | 624079 | + | NZ_CP066802.1 | Actinomyces weissii |
| 79 | 2395764 | 2395946 | - | NZ_LR134406.1 | Arachnia propionica |
| 80 | 1686555 | 1686740 | + | NZ_AP014945.1 | Caldimicrobium thiodismutans |
| 81 | 4267149 | 4267361 | - | NZ_CP029642.1 | Arthrobacter dokdonellae |
| 82 | 2795191 | 2795373 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| 83 | 196685 | 196870 | + | NC_007512.1 | Pelodictyon luteolum DSM 273 |
| 84 | 1260447 | 1260650 | + | NC_013235.1 | Nakamurella multipartita DSM 44233 |
| 85 | 412266 | 412448 | + | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 86 | 165037 | 165225 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 87 | 2991390 | 2991572 | + | NZ_CP047156.1 | Epidermidibacterium keratini |
| 88 | 2055487 | 2055672 | - | NC_002932.3 | Chlorobaculum tepidum TLS |
| 89 | 2669728 | 2669913 | - | NZ_CP017305.1 | Chlorobaculum limnaeum |
| 90 | 2642255 | 2642434 | - | NC_013172.1 | Brachybacterium faecium DSM 4810 |
| 91 | 6059558 | 6059734 | + | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 92 | 2325233 | 2325436 | - | NZ_CP034412.1 | Glutamicibacter creatinolyticus |
| 93 | 1875339 | 1875521 | - | NZ_CP019606.1 | Tessaracoccus aquimaris |
| 94 | 318917 | 319102 | + | NC_019897.1 | Thermobacillus composti KWC4 |
| 95 | 221509 | 221685 | - | NZ_CP034437.1 | Paenibacillus albus |
| 96 | 3024299 | 3024487 | - | NZ_CP043420.1 | Kushneria phosphatilytica |
| 97 | 1197969 | 1198148 | + | NZ_CP023536.1 | Providencia alcalifaciens |
| 98 | 2477502 | 2477684 | + | NZ_CP021376.1 | Oceanisphaera avium |
| 99 | 2046548 | 2046730 | + | NZ_CP021377.1 | Oceanisphaera profunda |
| 100 | 1032518 | 1032703 | - | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 101 | 2789681 | 2789866 | - | NC_008639.1 | Chlorobium phaeobacteroides DSM 266 |
| 102 | 1410258 | 1410443 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 103 | 694433 | 694624 | + | NZ_CP009302.1 | Berryella intestinalis |
| 104 | 472273 | 472455 | + | NC_013166.1 | Kangiella koreensis DSM 16069 |
| 105 | 296511 | 296696 | + | NC_011060.1 | Pelodictyon phaeoclathratiforme BU-1 |
| 106 | 2223046 | 2223246 | + | NZ_LT828648.1 | Nitrospira japonica |
| 107 | 240279 | 240461 | + | NZ_CP027523.1 | Pseudoalteromonas carrageenovora |
| 108 | 1558441 | 1558623 | - | NZ_CP019628.1 | Pseudoalteromonas aliena |
| 109 | 6309284 | 6309460 | - | NZ_CP048209.1 | Paenibacillus lycopersici |
| 110 | 2482854 | 2483060 | - | NZ_CP033081.1 | Glutamicibacter nicotianae |
| 111 | 5016367 | 5016552 | - | NC_010334.1 | Shewanella halifaxensis HAW-EB4 |
| 112 | 3120659 | 3120841 | - | NZ_CP011041.1 | Pseudoalteromonas tetraodonis |
| 113 | 3156207 | 3156389 | - | NZ_CP011030.1 | Pseudoalteromonas issachenkonii |
| 114 | 3597420 | 3597602 | - | NZ_CP011025.1 | Pseudoalteromonas arctica A 37-1-2 |
| 115 | 348652 | 348834 | + | NZ_CP032090.1 | Pseudoalteromonas donghaensis |
| 116 | 2989829 | 2990011 | - | NC_007481.1 | Pseudoalteromonas translucida |
| 117 | 3286281 | 3286463 | - | NZ_CP011036.1 | Pseudoalteromonas nigrifaciens |
| 118 | 155333 | 155518 | + | NZ_CP024955.1 | Kyrpidia spormannii |
| 119 | 161923 | 162108 | + | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 120 | 683341 | 683559 | + | NZ_CP036250.1 | Egicoccus halophilus |
| 121 | 4226396 | 4226572 | + | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 122 | 5489451 | 5489636 | - | NC_013440.1 | Haliangium ochraceum DSM 14365 |
| 123 | 2637082 | 2637288 | - | NC_014550.1 | Glutamicibacter arilaitensis Re117 |
| 124 | 1628377 | 1628565 | - | NZ_AP012333.1 | Parascardovia denticolens DSM 10105 = JCM 12538 |
| 125 | 2099843 | 2100028 | + | NC_011566.1 | Shewanella piezotolerans WP3 |
| 126 | 5276141 | 5276326 | - | NC_009831.1 | Shewanella sediminis HAW-EB3 |
| 127 | 5647790 | 5647972 | - | NC_010506.1 | Shewanella woodyi ATCC 51908 |
| 128 | 176439 | 176621 | + | NZ_CP022272.1 | Shewanella marisflavi |
| 129 | 187746 | 187928 | + | NC_009092.1 | Shewanella loihica PV-4 |
| 130 | 431285 | 431473 | + | NZ_CP034015.1 | Shewanella livingstonensis |
| 131 | 179085 | 179273 | + | NC_008345.1 | Shewanella frigidimarina NCIMB 400 |
| 132 | 218955 | 219140 | + | NC_009901.1 | Shewanella pealeana ATCC 700345 |
| 133 | 770110 | 770289 | + | NZ_CP032364.1 | Lachnoanaerobaculum umeaense |
| 134 | 198497 | 198682 | + | NC_011027.1 | Chlorobaculum parvum NCIB 8327 |
| 135 | 3820360 | 3820542 | - | NZ_CP012621.1 | Zobellella denitrificans |
| 136 | 204841 | 205023 | + | NC_007954.1 | Shewanella denitrificans OS217 |
| 137 | 1561304 | 1561486 | - | NZ_CP047141.1 | Ligilactobacillus animalis |
| 138 | 150452 | 150634 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 139 | 323324 | 323509 | + | NZ_CP009215.1 | Corynebacterium ureicelerivorans |
| 140 | 2472063 | 2472257 | - | NZ_LR134379.1 | Slackia heliotrinireducens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LS483468.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00253.23 | 0.85 | 119 | 2123 | same-strand | Ribosomal protein S14p/S29e |
| 2 | PF00410.21 | 1.0 | 140 | 1638.0 | same-strand | Ribosomal protein S8 |
| 3 | PF00347.25 | 1.0 | 140 | 1081.5 | same-strand | Ribosomal protein L6 |
| 4 | PF00861.24 | 0.99 | 139 | 682 | same-strand | Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast |
| 5 | PF03719.17 | 1.0 | 140 | 3.0 | same-strand | Ribosomal protein S5, C-terminal domain |
| 6 | PF00333.22 | 1.0 | 140 | 3.0 | same-strand | Ribosomal protein S5, N-terminal domain |
| 7 | PF00828.21 | 1.0 | 140 | 2.0 | same-strand | Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A |
| 8 | PF00344.22 | 0.64 | 89 | 608 | same-strand | SecY |
++ More..