Result : EXP01001
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01001 |
| NCBI Accession ID | NC_011916.1 |
| Organism | Caulobacter vibrioides NA1000 |
| Left | 2097338 |
| Right | 2097556 |
| Strand | + |
| Nucleotide Sequence | ATGGGCTGCGCCGCACCCGACCGCCTTTGGCACCTGACCCTTCGCAACCGCGCTGACGGTGCGACGGTCGGCGACGCGCGCGCCCTTCATTCATATCGGCGACCGGGCCAAGCGCCCGCAGCGCGCCGCGGAGACTTCCTTTATGTCGAAGAAGATGCTGATCGACGCAGCACACGCCGAAGAGACGCGTGTGGTCGTCGTGGACGGTACCCGGGTTGA |
| Sequence | MGCAAPDRLWHLTLRNRADGATVGDARALHSYRRPGQAPAARRGDFLYVEEDADRRSTRRRDACGRRGRYPG |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 25078267 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 72 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2097338 | 2097556 | + | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 2 | 2372721 | 2372939 | + | NZ_CP027850.1 | Caulobacter segnis |
| 3 | 1972008 | 1972226 | + | NZ_CP013002.1 | Caulobacter henricii |
| 4 | 2764167 | 2764385 | - | NZ_CP048815.1 | Caulobacter rhizosphaerae |
| 5 | 3872199 | 3872417 | - | NZ_CP026100.1 | Caulobacter flavus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011916.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01551.24 | 0.8 | 4 | 5998.0 | same-strand | Peptidase family M23 |
| 2 | PF04519.15 | 0.8 | 4 | 5536.5 | same-strand | Polymer-forming cytoskeletal |
| 3 | PF03462.20 | 0.8 | 4 | 4242.0 | opposite-strand | PCRF domain |
| 4 | PF00472.22 | 1.0 | 5 | 4311 | opposite-strand | RF-1 domain |
| 5 | PF00912.24 | 1.0 | 5 | 1721 | opposite-strand | Transglycosylase |
| 6 | PF00905.24 | 1.0 | 5 | 1721 | opposite-strand | Penicillin binding protein transpeptidase domain |
| 7 | PF17092.7 | 1.0 | 5 | 1721 | opposite-strand | Penicillin-binding protein OB-like domain |
| 8 | PF01520.20 | 1.0 | 5 | 404 | opposite-strand | N-acetylmuramoyl-L-alanine amidase |
| 9 | PF10150.11 | 1.0 | 5 | -76 | same-strand | Ribonuclease E/G family |
| 10 | PF01435.20 | 1.0 | 5 | 2769 | same-strand | Peptidase family M48 |
| 11 | PF13428.8 | 0.8 | 4 | 2769.0 | same-strand | Tetratricopeptide repeat |
| 12 | PF13432.8 | 1.0 | 5 | 2769 | same-strand | Tetratricopeptide repeat |
| 13 | PF01323.22 | 1.0 | 5 | 4218 | same-strand | DSBA-like thioredoxin domain |
| 14 | PF13462.8 | 1.0 | 5 | 4218 | same-strand | Thioredoxin |
| 15 | PF18312.3 | 1.0 | 5 | 4218 | same-strand | Copper resistance protein ScsC N-terminal domain |
| 16 | PF05690.16 | 1.0 | 5 | 4998 | opposite-strand | Thiazole biosynthesis protein ThiG |
| 17 | PF02597.22 | 0.8 | 4 | 5837.5 | opposite-strand | ThiS family |
++ More..