Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01000 |
NCBI Accession ID | NC_011916.1 |
Organism | Caulobacter vibrioides NA1000 |
Left | 2058655 |
Right | 2058888 |
Strand | + |
Nucleotide Sequence | ATGGCTGAGCCGATCGTTGTCGACGCGCGGGGCCATCACTGCCCGGTGCCGACCTTGAAGCTGCGCAAGGCGCATGAAGCGGCCCCCGCCGGGGCGGAGCTCGTGCTGTTGGCGACAGACCCGATGGCCAGGATCGATGCGCCGCATTTCGCGGGCCAGGTGGGCGCGGCAGTTCTCGACGTCACCGACCTGGACGGCGGTGTGATCAGGATTCGGATTCAGAAGGCGCCTTGA |
Sequence | MAEPIVVDARGHHCPVPTLKLRKAHEAAPAGAELVLLATDPMARIDAPHFAGQVGAAVLDVTDLDGGVIRIRIQKAP |
Source of smORF | Protein-level |
Function | The ORF matches to the profile of cl00436. Profile Description: N/A. Members of this family of hypothetical bacterial proteins have no known function. |
Pubmed ID | 25078267 |
Domain | CDD:412376 |
Functional Category | Conserved domain based functional assignment |
Uniprot ID | |
ORF Length (Amino Acid) | 77 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2058655 | 2058888 | + | NC_011916.1 | Caulobacter vibrioides NA1000 |
2 | 2332660 | 2332893 | + | NZ_CP027850.1 | Caulobacter segnis |
3 | 1882038 | 1882274 | - | NZ_CP013002.1 | Caulobacter henricii |
4 | 3831864 | 3832052 | - | NZ_CP026100.1 | Caulobacter flavus |
5 | 2820569 | 2820802 | - | NZ_CP048815.1 | Caulobacter rhizosphaerae |
6 | 1818351 | 1818581 | + | NC_011144.1 | Phenylobacterium zucineum HLK1 |
7 | 2416315 | 2416542 | + | NZ_CP024201.1 | Caulobacter mirabilis |
8 | 3198026 | 3198277 | - | NZ_CP022048.2 | Brevundimonas vesicularis |
9 | 1343089 | 1343352 | - | NZ_CP029479.1 | Phenylobacterium parvum |
10 | 1417886 | 1418131 | + | NZ_LR588407.1 | Brevundimonas vancanneytii |
11 | 1763320 | 1763556 | - | NC_014375.1 | Brevundimonas subvibrioides ATCC 15264 |
12 | 741932 | 742153 | + | NZ_CP049037.1 | Pseudohalocynthiibacter aestuariivivens |
13 | 1827069 | 1827296 | + | NZ_CP012661.1 | Defluviimonas alba |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03631.17 | 0.85 | 11 | -30 | opposite-strand | Virulence factor BrkB |
2 | PF00990.23 | 0.69 | 9 | 2465 | same-strand | Diguanylate cyclase, GGDEF domain |