Result : EXP01000
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01000 |
| NCBI Accession ID | NC_011916.1 |
| Organism | Caulobacter vibrioides NA1000 |
| Left | 2058655 |
| Right | 2058888 |
| Strand | + |
| Nucleotide Sequence | ATGGCTGAGCCGATCGTTGTCGACGCGCGGGGCCATCACTGCCCGGTGCCGACCTTGAAGCTGCGCAAGGCGCATGAAGCGGCCCCCGCCGGGGCGGAGCTCGTGCTGTTGGCGACAGACCCGATGGCCAGGATCGATGCGCCGCATTTCGCGGGCCAGGTGGGCGCGGCAGTTCTCGACGTCACCGACCTGGACGGCGGTGTGATCAGGATTCGGATTCAGAAGGCGCCTTGA |
| Sequence | MAEPIVVDARGHHCPVPTLKLRKAHEAAPAGAELVLLATDPMARIDAPHFAGQVGAAVLDVTDLDGGVIRIRIQKAP |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl00436. Profile Description: N/A. Members of this family of hypothetical bacterial proteins have no known function. |
| Pubmed ID | 25078267 |
| Domain | CDD:412376 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 77 |
++ More..
| Conservation Analysis |
No. of Species: 13
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2058655 | 2058888 | + | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 2 | 2332660 | 2332893 | + | NZ_CP027850.1 | Caulobacter segnis |
| 3 | 1882038 | 1882274 | - | NZ_CP013002.1 | Caulobacter henricii |
| 4 | 3831864 | 3832052 | - | NZ_CP026100.1 | Caulobacter flavus |
| 5 | 2820569 | 2820802 | - | NZ_CP048815.1 | Caulobacter rhizosphaerae |
| 6 | 1818351 | 1818581 | + | NC_011144.1 | Phenylobacterium zucineum HLK1 |
| 7 | 2416315 | 2416542 | + | NZ_CP024201.1 | Caulobacter mirabilis |
| 8 | 3198026 | 3198277 | - | NZ_CP022048.2 | Brevundimonas vesicularis |
| 9 | 1343089 | 1343352 | - | NZ_CP029479.1 | Phenylobacterium parvum |
| 10 | 1417886 | 1418131 | + | NZ_LR588407.1 | Brevundimonas vancanneytii |
| 11 | 1763320 | 1763556 | - | NC_014375.1 | Brevundimonas subvibrioides ATCC 15264 |
| 12 | 741932 | 742153 | + | NZ_CP049037.1 | Pseudohalocynthiibacter aestuariivivens |
| 13 | 1827069 | 1827296 | + | NZ_CP012661.1 | Defluviimonas alba |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011916.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03631.17 | 0.85 | 11 | -30 | opposite-strand | Virulence factor BrkB |
| 2 | PF00990.23 | 0.69 | 9 | 2465 | same-strand | Diguanylate cyclase, GGDEF domain |
++ More..