Result : EXP00996
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00996 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 2658282 |
| Right | 2658536 |
| Strand | - |
| Nucleotide Sequence | ATCCCCGCCTCACCGCCATTTGCATCCGTAGCTCAGCTGGATAGAGTACTCGGCTACGAACCGAGCGGTCGGAGGTTCGAATCCTCCCGGATGCACCATATTCTACGTACTTTCAGCGATGAAGGTATGGAAGAGGTGGCGGTAATAACCGCAGGCACCAGGGAGGATAACGTTGCTTTAGCAACGGCCCGAAGGGCGAGCCGCAAGGCGAGTAATCCTCCCGGATGCACCATCTCTTACTTGATACGGCTTTAG |
| Sequence | IPASPPFASVAQLDRVLGYEPSGRRFESSRMHHILRTFSDEGMEEVAVITAGTREDNVALATARRASRKASNPPGCTISYLIRL |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 84 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2818316 | 2818600 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 2969756 | 2970055 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 3 | 931051 | 931278 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 4 | 2973849 | 2974094 | + | NZ_CP011254.1 | Serratia fonticola |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02664.17 | 1.0 | 4 | 3380.5 | same-strand | S-Ribosylhomocysteinase (LuxS) |
| 2 | PF04262.16 | 1.0 | 4 | 1636.5 | same-strand | Glutamate-cysteine ligase |
| 3 | PF09335.13 | 1.0 | 4 | 1128.0 | same-strand | SNARE associated Golgi protein |
| 4 | PF13419.8 | 1.0 | 4 | 563.5 | same-strand | Haloacid dehalogenase-like hydrolase |
| 5 | PF00702.28 | 1.0 | 4 | 563.5 | same-strand | haloacid dehalogenase-like hydrolase |
| 6 | PF02599.18 | 1.0 | 4 | 639.0 | same-strand | Global regulator protein family |
| 7 | PF01411.21 | 1.0 | 4 | 1069.0 | same-strand | tRNA synthetases class II (A) |
| 8 | PF02272.21 | 1.0 | 4 | 1069.0 | same-strand | DHHA1 domain |
| 9 | PF07973.16 | 1.0 | 4 | 1069.0 | same-strand | Threonyl and Alanyl tRNA synthetase second additional domain |
| 10 | PF02631.18 | 1.0 | 4 | 3881.5 | same-strand | RecX family |
| 11 | PF00154.23 | 1.0 | 4 | 4486.0 | same-strand | recA bacterial DNA recombination protein |
| 12 | PF08423.13 | 1.0 | 4 | 4486.0 | same-strand | Rad51 |
| 13 | PF02464.19 | 1.0 | 4 | 5647.5 | same-strand | Competence-damaged protein |
++ More..