Result : EXP00993
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00993 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 1384412 |
| Right | 1384570 |
| Strand | - |
| Nucleotide Sequence | TTGATAATATCATTGAGCGGAAGAAGCCTATTCAGAAAGGCCAGACGCTGTTTAAGGCTGGTGATGAACTTAAATCGCTTTATGCCATCCGCTCCGGTACGATTAAAAGTTATACCATCACTGAGCAAGGCGACGAGCAAATCACTGGTTTTCATTTAG |
| Sequence | LIISLSGRSLFRKARRCLRLVMNLNRFMPSAPVRLKVIPSLSKATSKSLVFI |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 52 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1907540 | 1907698 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 1399244 | 1399402 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 2299348 | 2299506 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 1875868 | 1876014 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 5 | 2353494 | 2353640 | + | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 1444848 | 1444994 | - | NZ_AP014857.1 | Escherichia albertii |
| 7 | 2274342 | 2274500 | - | NZ_CP043727.1 | Yersinia canariae |
| 8 | 1834317 | 1834487 | - | NZ_LS483470.1 | Leminorella richardii |
| 9 | 385712 | 385858 | + | NZ_CP072133.1 | Pseudoalteromonas xiamenensis |
| 10 | 2040162 | 2040320 | - | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 11 | 1791915 | 1792073 | - | NZ_CP032487.1 | Yersinia hibernica |
| 12 | 1083668 | 1083826 | + | NZ_CP038469.1 | Citrobacter tructae |
| 13 | 2376041 | 2376199 | + | NZ_CP011118.1 | Yersinia enterocolitica |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00582.28 | 1.0 | 12 | 622 | same-strand | Universal stress protein family |
| 2 | PF00325.22 | 1.0 | 12 | -158 | same-strand | Bacterial regulatory proteins, crp family |
| 3 | PF13545.8 | 1.0 | 12 | -158 | same-strand | Crp-like helix-turn-helix domain |
| 4 | PF00027.31 | 1.0 | 12 | -158 | same-strand | Cyclic nucleotide-binding domain |
| 5 | PF01035.22 | 0.83 | 10 | 319 | same-strand | 6-O-methylguanine DNA methyltransferase, DNA binding domain |
| 6 | PF02870.17 | 0.83 | 10 | 319 | same-strand | 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain |
++ More..