Result : B2GIP0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Prokaryotic ubiquitin-like protein Pup (Bacterial ubiquitin-like modifier) |
| NCBI Accession ID | AP009152.1 |
| Organism | Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) |
| Left | 1563319 |
| Right | 1563525 |
| Strand | - |
| Nucleotide Sequence | ATGGCACAGGAACGCATCTTCGGCACCGGCTCCCGGCGCGAGGACGAGCCCGACACCCCCGCCCCCGTGGACCCGCCCGTCTCCGGGGCCGCCCAGGCGCAGCGGGATATGCAGGGCACCGACGACCTGCTCGCCGAGATCGACGGCGTGCTCGAGACCAACGCGGAGGCCTTCGTCAAGGGCTTCGTCCAGAAGGGCGGTCAGTGA |
| Sequence | MAQERIFGTGSRREDEPDTPAPVDPPVSGAAQAQRDMQGTDDLLAEIDGVLETNAEAFVKGFVQKGGQ |
| Source of smORF | Swiss-Prot |
| Function | Protein modifier that is covalently attached to lysine residues of substrate proteins, thereby targeting them for proteasomal degradation. The tagging system is termed pupylation. {ECO:0000255|HAMAP-Rule:MF_02106}. |
| Pubmed ID | 18408034 |
| Domain | CDD:391659 |
| Functional Category | Others |
| Uniprot ID | B2GIP0 |
| ORF Length (Amino Acid) | 68 |
++ More..
| Conservation Analysis |
No. of Species: 40
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1601416 | 1601622 | - | NZ_CP035504.1 | Kocuria indica |
| 2 | 2413024 | 2413230 | + | NZ_CP013254.1 | Kocuria flava |
| 3 | 1030668 | 1030868 | - | NZ_CP046883.1 | Corynebacterium anserum |
| 4 | 2555505 | 2555711 | + | NZ_CP029642.1 | Arthrobacter dokdonellae |
| 5 | 1377047 | 1377238 | + | NZ_CP009249.1 | Corynebacterium phocae |
| 6 | 1802570 | 1802770 | - | NC_010168.1 | Renibacterium salmoninarum ATCC 33209 |
| 7 | 1392931 | 1393122 | - | NZ_CP009251.1 | Corynebacterium stationis |
| 8 | 231731 | 231925 | - | NZ_LT906443.1 | Corynebacterium ulcerans |
| 9 | 941613 | 941813 | + | NZ_CP011005.1 | Psychromicrobium lacuslunae |
| 10 | 1288450 | 1288647 | - | NC_021663.1 | Corynebacterium terpenotabidum Y-11 |
| 11 | 1873055 | 1873234 | + | NZ_CP006842.1 | Corynebacterium glyciniphilum AJ 3170 |
| 12 | 1716599 | 1716784 | - | NZ_CP011542.1 | Corynebacterium mustelae |
| 13 | 542311 | 542508 | + | NZ_LT906481.1 | Corynebacterium urealyticum |
| 14 | 1214007 | 1214198 | + | NZ_CP012117.1 | Dermabacter vaginalis |
| 15 | 1294556 | 1294726 | - | NZ_CP007790.1 | Corynebacterium marinum DSM 44953 |
| 16 | 1471626 | 1471817 | - | NC_021915.1 | Corynebacterium maris DSM 45190 |
| 17 | 1572333 | 1572527 | + | NZ_LS483459.1 | Corynebacterium jeikeium |
| 18 | 1096692 | 1096880 | - | NZ_CP011312.1 | Corynebacterium kutscheri |
| 19 | 1450804 | 1450980 | - | NZ_CP006764.1 | Corynebacterium doosanense CAU 212 = DSM 45436 |
| 20 | 2229673 | 2229867 | - | NC_014151.1 | Cellulomonas flavigena DSM 20109 |
| 21 | 2832071 | 2832262 | - | NZ_CP065682.1 | Brevibacterium casei |
| 22 | 2381076 | 2381279 | + | NZ_CP068013.1 | Paenarthrobacter ureafaciens |
| 23 | 2801256 | 2801456 | - | NZ_CP041694.1 | Cellulosimicrobium cellulans |
| 24 | 507781 | 507972 | - | NZ_LN849456.1 | Devriesea agamarum |
| 25 | 1705868 | 1706059 | - | NC_004369.1 | Corynebacterium efficiens YS-314 |
| 26 | 1475047 | 1475256 | - | NZ_CP012507.1 | Kocuria palustris |
| 27 | 2834237 | 2834428 | + | NZ_CP041695.1 | Nocardia otitidiscaviarum |
| 28 | 1981413 | 1981592 | + | NC_015514.1 | Cellulomonas fimi ATCC 484 |
| 29 | 807704 | 807886 | + | NZ_CP044548.2 | Janibacter melonis |
| 30 | 3101414 | 3101632 | - | NC_007777.1 | Frankia casuarinae |
| 31 | 2816019 | 2816207 | - | NZ_LR134363.1 | Actinomyces slackii |
| 32 | 4226807 | 4227001 | + | NZ_CP026746.1 | Nocardia cyriacigeorgica |
| 33 | 366908 | 367081 | + | NZ_CP034438.1 | Flaviflexus salsibiostraticola |
| 34 | 4712812 | 4713006 | - | NZ_LR134352.1 | Nocardia asteroides |
| 35 | 2573589 | 2573783 | + | NZ_CP018082.1 | Nocardia mangyaensis |
| 36 | 961867 | 962061 | + | NZ_CP022088.2 | Nocardia brasiliensis |
| 37 | 9380708 | 9380926 | - | NZ_AP022871.1 | Phytohabitans suffuscus |
| 38 | 355395 | 355592 | - | NC_009664.2 | Kineococcus radiotolerans SRS30216 = ATCC BAA-149 |
| 39 | 2253986 | 2254180 | + | NC_014158.1 | Tsukamurella paurometabola DSM 20162 |
| 40 | 1875496 | 1875699 | - | NZ_CP051884.1 | Cellulomonas taurus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP035504.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03136.17 | 1.0 | 40 | 100.5 | same-strand | Pup-ligase protein |
| 2 | PF00004.31 | 0.82 | 33 | 1722 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 3 | PF17758.3 | 0.82 | 33 | 1722 | same-strand | Proteasomal ATPase OB N-terminal domain |
| 4 | PF16450.7 | 0.82 | 33 | 1722 | same-strand | Proteasomal ATPase OB C-terminal domain |
| 5 | PF14801.8 | 0.68 | 27 | 3425 | same-strand | tRNA methyltransferase complex GCD14 subunit N-term |
++ More..