Result : EXP00981
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00981 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 3403621 |
| Right | 3403776 |
| Strand | - |
| Nucleotide Sequence | ATGTTCAATCAGACAATAGATGTATCCTGGTCCTTGTTCCGTTTTCACCGACCACAGCACATCGGAATAGCTTTCACGCAGATCGTCATCAATAAAGCTGCTCGACTCCAGCTTGAGGGTTTTCATATCACAGAGCGCGTGAATGGGTGCCGGTAA |
| Sequence | MFNQTIDVSWSLFRFHRPQHIGIAFTQIVINKAARLQLEGFHITERVNGCR |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 51 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3543260 | 3543415 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 3512527 | 3512682 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 4255563 | 4255718 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 2445421 | 2445576 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 5 | 4027579 | 4027734 | - | NZ_LR134340.1 | Escherichia marmotae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09371.12 | 1.0 | 4 | 3535 | opposite-strand | Tex-like protein N-terminal domain |
| 2 | PF16921.7 | 1.0 | 4 | 3535 | opposite-strand | Tex protein YqgF-like domain |
| 3 | PF12836.9 | 1.0 | 4 | 3535 | opposite-strand | Helix-hairpin-helix motif |
| 4 | PF00575.25 | 1.0 | 4 | 3535 | opposite-strand | S1 RNA binding domain |
| 5 | PF17674.3 | 1.0 | 4 | 3535 | opposite-strand | HHH domain |
| 6 | PF14635.8 | 1.0 | 4 | 3535 | opposite-strand | Helix-hairpin-helix motif |
| 7 | PF14639.8 | 1.0 | 4 | 3535 | opposite-strand | Holliday-junction resolvase-like of SPT6 |
| 8 | PF04023.16 | 1.0 | 4 | 2870 | opposite-strand | FeoA domain |
| 9 | PF02421.20 | 1.0 | 4 | 532 | opposite-strand | Ferrous iron transport protein B |
| 10 | PF07670.16 | 1.0 | 4 | 532 | opposite-strand | Nucleoside recognition |
| 11 | PF01926.25 | 1.0 | 4 | 532 | opposite-strand | 50S ribosome-binding GTPase |
| 12 | PF07664.14 | 1.0 | 4 | 532 | opposite-strand | Ferrous iron transport protein B C terminus |
| 13 | PF17910.3 | 1.0 | 4 | 532 | opposite-strand | FeoB cytosolic helical domain |
| 14 | PF09012.12 | 1.0 | 4 | 296 | opposite-strand | FeoC like transcriptional regulator |
| 15 | PF04754.14 | 1.0 | 4 | -155 | opposite-strand | Putative transposase, YhgA-like |
| 16 | PF00561.22 | 1.0 | 4 | 865 | same-strand | alpha/beta hydrolase fold |
| 17 | PF12697.9 | 1.0 | 4 | 865 | same-strand | Alpha/beta hydrolase family |
| 18 | PF12146.10 | 1.0 | 4 | 865 | same-strand | Serine aminopeptidase, S33 |
| 19 | PF00975.22 | 1.0 | 4 | 865 | same-strand | Thioesterase domain |
| 20 | PF18912.2 | 0.75 | 3 | 1570.0 | opposite-strand | Double zinc ribbon domain |
| 21 | PF01106.19 | 0.75 | 3 | 2312.5 | opposite-strand | NifU-like domain |
| 22 | PF01521.22 | 0.75 | 3 | 2312.5 | opposite-strand | Iron-sulphur cluster biosynthesis |
++ More..