Result : EXP00978
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00978 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 3639085 |
| Right | 3639225 |
| Strand | - |
| Nucleotide Sequence | TTGTTGATCGCACAGCCTGTTGATAGCGCTGAATTTGCATTGCATACAAACTGGAGTCTGCTGGTTCAAACTGTGGCGGCGGTGGTAACGCCGCCACGCAGTGCAGTTCACCAAAGGGTCCAAGGATTTCGTCGTCGGTAA |
| Sequence | LLIAQPVDSAEFALHTNWSLLVQTVAAVVTPPRSAVHQRVQGFRRR |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 46 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3775957 | 3776097 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 3741850 | 3741990 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 4516894 | 4517034 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 103440 | 103580 | + | NZ_LR134340.1 | Escherichia marmotae |
| 5 | 3732426 | 3732566 | - | NZ_AP014857.1 | Escherichia albertii |
| 6 | 3556824 | 3556961 | + | NZ_CP038469.1 | Citrobacter tructae |
| 7 | 4644849 | 4644986 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00529.22 | 1.0 | 6 | 4578 | same-strand | Cation efflux system protein CusB domain 1 |
| 2 | PF13533.8 | 1.0 | 6 | 4578 | same-strand | Biotin-lipoyl like |
| 3 | PF11742.10 | 1.0 | 6 | 4213 | same-strand | Protein of unknown function (DUF3302) |
| 4 | PF00359.24 | 1.0 | 6 | 1763 | opposite-strand | Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2 |
| 5 | PF02378.20 | 1.0 | 6 | 1763 | opposite-strand | Phosphotransferase system, EIIC |
| 6 | PF02302.19 | 1.0 | 6 | 1763 | opposite-strand | PTS system, Lactose/Cellobiose specific IIB subunit |
| 7 | PF08125.15 | 1.0 | 6 | 385 | opposite-strand | Mannitol dehydrogenase C-terminal domain |
| 8 | PF01232.25 | 1.0 | 6 | 385 | opposite-strand | Mannitol dehydrogenase Rossmann domain |
| 9 | PF05068.14 | 1.0 | 6 | -140 | opposite-strand | Mannitol repressor |
| 10 | PF10928.10 | 1.0 | 6 | 568 | opposite-strand | Protein of unknown function (DUF2810) |
| 11 | PF05658.16 | 0.83 | 5 | 2200 | opposite-strand | Head domain of trimeric autotransporter adhesin |
| 12 | PF13018.8 | 0.83 | 5 | 2200 | opposite-strand | Extended Signal Peptide of Type V secretion system |
| 13 | PF05662.16 | 0.67 | 4 | 2195.5 | opposite-strand | Coiled stalk of trimeric autotransporter adhesin |
| 14 | PF03895.17 | 0.67 | 4 | 2195.5 | opposite-strand | YadA-like membrane anchor domain |
++ More..