| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00967 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 2797255 |
| Right | 2797392 |
| Strand | - |
| Nucleotide Sequence | TTGAACAGTCGCAACGTTTCCTGTTACCGCTGTTTCGCTTTAATCAGTCATGAGTGCTGTATAAAAATTGCGCAATTCATTCGCTTACATTATGATGCGCACCAGTCACGGACTGATGGATATATAGACATAGGCTGA |
| Sequence | LNSRNVSCYRCFALISHECCIKIAQFIRLHYDAHQSRTDGYIDIG |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 45 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2958975 | 2959112 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 792375 | 792512 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 3 | 2919299 | 2919436 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 3681502 | 3681639 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 3442854 | 3442991 | - | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 1746869 | 1746988 | - | NZ_CP033744.1 | Citrobacter freundii |
| 7 | 4319612 | 4319731 | + | NZ_CP038469.1 | Citrobacter tructae |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01520.20 | 1.0 | 6 | 9965 | same-strand | N-acetylmuramoyl-L-alanine amidase |
| 2 | PF11741.10 | 1.0 | 6 | 9965 | same-strand | AMIN domain |
| 3 | PF00696.30 | 1.0 | 6 | 8402 | opposite-strand | Amino acid kinase family |
| 4 | PF13508.9 | 1.0 | 6 | 8402 | opposite-strand | Acetyltransferase (GNAT) domain |
| 5 | PF13245.8 | 1.0 | 6 | 4755.5 | same-strand | AAA domain |
| 6 | PF05127.16 | 0.67 | 4 | 6514 | same-strand | Helicase |
| 7 | PF13538.8 | 1.0 | 6 | 6514 | same-strand | UvrD-like helicase C-terminal domain |
| 8 | PF13401.8 | 1.0 | 6 | 6514 | same-strand | AAA domain |
| 9 | PF00580.23 | 1.0 | 6 | 2972 | same-strand | UvrD/REP helicase N-terminal domain |
| 10 | PF16187.7 | 1.0 | 6 | 91 | same-strand | Middle or third domain of peptidase M16 |
| 11 | PF05193.23 | 1.0 | 6 | 91 | same-strand | Peptidase M16 inactive domain |
| 12 | PF00675.22 | 1.0 | 6 | 91 | same-strand | Insulinase (Peptidase family M16) |
| 13 | PF04257.16 | 1.0 | 6 | -52 | same-strand | Exodeoxyribonuclease V, gamma subunit |
| 14 | PF17946.3 | 1.0 | 6 | -52 | same-strand | RecC C-terminal domain |
| 15 | PF12528.10 | 1.0 | 6 | 3329 | same-strand | Type II secretion prepilin peptidase dependent protein C |
| 16 | PF07963.14 | 1.0 | 6 | 4041.0 | same-strand | Prokaryotic N-terminal methylation motif |
| 17 | PF10713.11 | 1.0 | 6 | 3637 | same-strand | Protein of unknown function (DUF2509) |
| 18 | PF13361.8 | 1.0 | 6 | 2972.0 | same-strand | UvrD-like helicase C-terminal domain |