ProsmORF-pred
Result : EXP00965
Protein Information
Information Type Description
Protein name EXP00965
NCBI Accession ID CP001509.3
Organism Escherichia coli BL21(DE3)
Left 1947321
Right 1947434
Strand -
Nucleotide Sequence TTGTTATTTAAAAAATTGATAGTGCACATTGTAACCAGCCAATATAAGCAATGGCGTGAGCACAGGTATCTTTCTCTGTTGGCCGTATTGTGTATGGAATCCGTTATTGGTTAA
Sequence LLFKKLIVHIVTSQYKQWREHRYLSLLAVLCMESVIG
Source of smORF Ribo-seq
Function
Pubmed ID 30904393
Domain
Functional Category Function not yet assigned
Uniprot ID
ORF Length (Amino Acid) 37
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 2
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 2666849 2666962 - NC_002695.2 Escherichia coli O157:H7 str. Sakai
2 2042174 2042287 - NC_000913.3 Escherichia coli str. K-12 substr. MG1655
3 2635890 2636003 - NZ_CP061527.1 Shigella dysenteriae
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_002695.2
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF00174.21 1.0 2 1692 opposite-strand Oxidoreductase molybdopterin binding domain
2 PF01794.21 1.0 2 1056 opposite-strand Ferric reductase like transmembrane component
3 PF09223.13 1.0 2 149 opposite-strand ZinT (YodA) periplasmic lipocalin-like zinc-recruitment
++ More..