Result : B2GD58
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
| NCBI Accession ID | AP008937.1 |
| Organism | Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) |
| Left | 1443135 |
| Right | 1443419 |
| Strand | - |
| Nucleotide Sequence | ATGATCTTATTTCCATCCGTTGATAAGCTATTAGAGCGGGTTGACTCCCGTTACTCACTAATCATGTTGGCTAGCAAGCGGGCCCACGAAATCGACAAGTACCGGATCGATAAGTGGCGGGCGGCCCACCCGGATAAGGCTGGCGAAACGGTCAGCTTAGAAGGCGACAAGCCGCTCTTGTTGGACCACTATGACTCCAACAAGTCCGTTGGGATGGCGCTGGAAGAAATCGAAGCGGGATTGGTAACGATCGACCCCGACCAACACGAAGACTTACAAGATTAA |
| Sequence | MILFPSVDKLLERVDSRYSLIMLASKRAHEIDKYRIDKWRAAHPDKAGETVSLEGDKPLLLDHYDSNKSVGMALEEIEAGLVTIDPDQHEDLQD |
| Source of smORF | Swiss-Prot |
| Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
| Pubmed ID | 18487258 |
| Domain | CDD:417484 |
| Functional Category | Others |
| Uniprot ID | B2GD58 |
| ORF Length (Amino Acid) | 94 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1263921 | 1264163 | + | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 2 | 1480531 | 1480788 | + | NZ_CP046037.1 | Latilactobacillus sakei |
| 3 | 409559 | 409798 | - | NZ_CP037940.1 | Weissella cryptocerci |
| 4 | 610721 | 610951 | + | NZ_CP027563.1 | Weissella confusa |
| 5 | 1564315 | 1564563 | - | NZ_AP012544.1 | Lacticaseibacillus casei DSM 20011 = JCM 1134 = ATCC 393 |
| 6 | 1568473 | 1568721 | - | NZ_LS991421.1 | Lacticaseibacillus zeae |
| 7 | 1586946 | 1587194 | - | NC_014334.2 | Lacticaseibacillus paracasei |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP040586.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01316.23 | 0.71 | 5 | 3790 | same-strand | Arginine repressor, DNA binding domain |
| 2 | PF02863.20 | 0.71 | 5 | 3790 | same-strand | Arginine repressor, C-terminal domain |
| 3 | PF02463.21 | 0.86 | 6 | 2092.5 | same-strand | RecF/RecN/SMC N terminal domain |
| 4 | PF00625.23 | 1.0 | 7 | 5 | same-strand | Guanylate kinase |
| 5 | PF18074.3 | 0.71 | 5 | 1418 | same-strand | Primosomal protein N C-terminal domain |
| 6 | PF17764.3 | 0.71 | 5 | 1418 | same-strand | 3'DNA-binding domain (3'BD) |
| 7 | PF04851.17 | 0.71 | 5 | 1418 | same-strand | Type III restriction enzyme, res subunit |
| 8 | PF00270.31 | 0.71 | 5 | 1418 | same-strand | DEAD/DEAH box helicase |
| 9 | PF18319.3 | 0.71 | 5 | 1418 | same-strand | PriA DNA helicase Cys-rich region (CRR) domain |
++ More..