Result : EXP00955
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00955 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 3741192 |
| Right | 3741287 |
| Strand | - |
| Nucleotide Sequence | GTGTGGTGGTGGTCGTCGGCAATGCGCCGTAGGGACTGGAACAACACACGATTCCAAAACCCCGCCGGCGCAAACCGGGCGGGGTTTTTCGTTTAA |
| Sequence | VWWWSSAMRRRDWNNTRFQNPAGANRAGFFV |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 31 |
++ More..
| Conservation Analysis |
No. of Species: 25
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4643426 | 4643521 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 3852826 | 3852921 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 2921378 | 2921473 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 4 | 22253 | 22348 | + | NZ_LR134340.1 | Escherichia marmotae |
| 5 | 34232 | 34327 | + | NC_015968.1 | Enterobacter soli |
| 6 | 12164 | 12259 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 7 | 4101240 | 4101335 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 8 | 423645 | 423740 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 9 | 1337554 | 1337649 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 10 | 1814211 | 1814306 | - | NZ_CP053416.1 | Salmonella bongori |
| 11 | 4299354 | 4299449 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 12 | 33513 | 33608 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 13 | 3266441 | 3266536 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 14 | 35001 | 35096 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 15 | 2552978 | 2553073 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 16 | 28760 | 28855 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 17 | 31360 | 31455 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 18 | 33418 | 33513 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 19 | 2418815 | 2418910 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 20 | 3540005 | 3540100 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 21 | 4832605 | 4832700 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 22 | 3074662 | 3074757 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 23 | 4596300 | 4596395 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 24 | 18576 | 18668 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 25 | 3456379 | 3456465 | + | NZ_CP038469.1 | Citrobacter tructae |
| 26 | 930034 | 930126 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13710.8 | 1.0 | 25 | 1734.5 | same-strand | ACT domain |
| 2 | PF01842.27 | 1.0 | 25 | 1734.5 | same-strand | ACT domain |
| 3 | PF13291.8 | 1.0 | 25 | 1734.5 | same-strand | ACT domain |
| 4 | PF02776.20 | 1.0 | 25 | 42.0 | same-strand | Thiamine pyrophosphate enzyme, N-terminal TPP binding domain |
| 5 | PF02775.23 | 1.0 | 25 | 42.0 | same-strand | Thiamine pyrophosphate enzyme, C-terminal TPP binding domain |
| 6 | PF00205.24 | 1.0 | 25 | 42.0 | same-strand | Thiamine pyrophosphate enzyme, central domain |
| 7 | PF13939.8 | 0.84 | 21 | 605.0 | opposite-strand | Toxin TisB, type I toxin-antitoxin system |
| 8 | PF07690.18 | 0.88 | 22 | 2290.5 | opposite-strand | Major Facilitator Superfamily |
| 9 | PF05231.16 | 0.64 | 16 | 2694.5 | same-strand | MASE1 |
| 10 | PF07730.15 | 0.64 | 16 | 2694.5 | same-strand | Histidine kinase |
| 11 | PF02518.28 | 0.64 | 16 | 2694.5 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 12 | PF00072.26 | 0.64 | 16 | 2104.5 | same-strand | Response regulator receiver domain |
| 13 | PF00196.21 | 0.64 | 16 | 2104.5 | same-strand | Bacterial regulatory proteins, luxR family |
++ More..