Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00955 |
NCBI Accession ID | CP001509.3 |
Organism | Escherichia coli BL21(DE3) |
Left | 3741192 |
Right | 3741287 |
Strand | - |
Nucleotide Sequence | GTGTGGTGGTGGTCGTCGGCAATGCGCCGTAGGGACTGGAACAACACACGATTCCAAAACCCCGCCGGCGCAAACCGGGCGGGGTTTTTCGTTTAA |
Sequence | VWWWSSAMRRRDWNNTRFQNPAGANRAGFFV |
Source of smORF | Ribo-seq |
Function | |
Pubmed ID | 30904393 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 31 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 4643426 | 4643521 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
2 | 3852826 | 3852921 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
3 | 2921378 | 2921473 | + | NZ_CP057657.1 | Escherichia fergusonii |
4 | 22253 | 22348 | + | NZ_LR134340.1 | Escherichia marmotae |
5 | 34232 | 34327 | + | NC_015968.1 | Enterobacter soli |
6 | 12164 | 12259 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
7 | 4101240 | 4101335 | + | NZ_CP061527.1 | Shigella dysenteriae |
8 | 423645 | 423740 | - | NZ_CP045205.1 | Citrobacter telavivensis |
9 | 1337554 | 1337649 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
10 | 1814211 | 1814306 | - | NZ_CP053416.1 | Salmonella bongori |
11 | 4299354 | 4299449 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
12 | 33513 | 33608 | + | NZ_CP043318.1 | Enterobacter chengduensis |
13 | 3266441 | 3266536 | + | NZ_CP017279.1 | Enterobacter ludwigii |
14 | 35001 | 35096 | + | NZ_CP009756.1 | Enterobacter cloacae |
15 | 2552978 | 2553073 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
16 | 28760 | 28855 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
17 | 31360 | 31455 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
18 | 33418 | 33513 | + | NZ_AP022508.1 | Enterobacter bugandensis |
19 | 2418815 | 2418910 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
20 | 3540005 | 3540100 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
21 | 4832605 | 4832700 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
22 | 3074662 | 3074757 | - | NZ_CP016337.1 | Kosakonia sacchari |
23 | 4596300 | 4596395 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
24 | 18576 | 18668 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
25 | 3456379 | 3456465 | + | NZ_CP038469.1 | Citrobacter tructae |
26 | 930034 | 930126 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13710.8 | 1.0 | 25 | 1734.5 | same-strand | ACT domain |
2 | PF01842.27 | 1.0 | 25 | 1734.5 | same-strand | ACT domain |
3 | PF13291.8 | 1.0 | 25 | 1734.5 | same-strand | ACT domain |
4 | PF02776.20 | 1.0 | 25 | 42.0 | same-strand | Thiamine pyrophosphate enzyme, N-terminal TPP binding domain |
5 | PF02775.23 | 1.0 | 25 | 42.0 | same-strand | Thiamine pyrophosphate enzyme, C-terminal TPP binding domain |
6 | PF00205.24 | 1.0 | 25 | 42.0 | same-strand | Thiamine pyrophosphate enzyme, central domain |
7 | PF13939.8 | 0.84 | 21 | 605.0 | opposite-strand | Toxin TisB, type I toxin-antitoxin system |
8 | PF07690.18 | 0.88 | 22 | 2290.5 | opposite-strand | Major Facilitator Superfamily |
9 | PF05231.16 | 0.64 | 16 | 2694.5 | same-strand | MASE1 |
10 | PF07730.15 | 0.64 | 16 | 2694.5 | same-strand | Histidine kinase |
11 | PF02518.28 | 0.64 | 16 | 2694.5 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
12 | PF00072.26 | 0.64 | 16 | 2104.5 | same-strand | Response regulator receiver domain |
13 | PF00196.21 | 0.64 | 16 | 2104.5 | same-strand | Bacterial regulatory proteins, luxR family |