| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00936 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 1418600 |
| Right | 1418785 |
| Strand | - |
| Nucleotide Sequence | ATGATTAAACCTTTACGCGTAATGCGTGGGCTTTCATCTAATGCAATACGTGTCCCGAGCGGTAGCCAGATGCCCGCCAGCGTGGGAACCCACAGCCCGAGCGTCATCAGCAGCGTCAACGGCACAAGAATAATCAGTAATAACAGCGCGAGAACGGCTTTATATTTACCCAGCATGGGTAGTTAA |
| Sequence | MIKPLRVMRGLSSNAIRVPSGSQMPASVGTHSPSVISSVNGTRIISNNSARTALYLPSMGS |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 61 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2258034 | 2258219 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 2 | 1443041 | 1443226 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 1980680 | 1980865 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 1852425 | 1852610 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 5 | 2286664 | 2286828 | + | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 1463883 | 1464068 | - | NZ_AP014857.1 | Escherichia albertii |
| 7 | 3037177 | 3037344 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 8 | 3908651 | 3908818 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 9 | 654153 | 654317 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 10 | 2146964 | 2147137 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 11 | 1035009 | 1035188 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 12 | 2155614 | 2155781 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 13 | 1327187 | 1327360 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 14 | 2159257 | 2159418 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 15 | 2821132 | 2821317 | + | NZ_CP041247.1 | Raoultella electrica |
| 16 | 2620946 | 2621131 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 17 | 2566375 | 2566560 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 18 | 3273717 | 3273890 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 19 | 2499544 | 2499696 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 20 | 3226681 | 3226854 | + | NZ_CP050508.1 | Raoultella terrigena |
| 21 | 2329924 | 2330103 | + | NZ_AP023184.1 | Buttiauxella agrestis |
| 22 | 2417391 | 2417564 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 23 | 4026539 | 4026703 | + | NZ_CP040428.1 | Jejubacter calystegiae |
| 24 | 2162803 | 2162973 | - | NZ_LR134201.1 | Cedecea lapagei |
| 25 | 2277713 | 2277880 | - | NZ_CP035129.1 | Kosakonia cowanii |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13617.8 | 1.0 | 24 | 2476 | opposite-strand | YnbE-like lipoprotein |
| 2 | PF11739.10 | 1.0 | 24 | -163 | opposite-strand | Dicarboxylate transport |
| 3 | PF02826.21 | 0.96 | 23 | 202.5 | same-strand | D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain |
| 4 | PF00389.32 | 0.96 | 23 | 202.5 | same-strand | D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain |
| 5 | PF03724.18 | 0.79 | 19 | 1488.5 | same-strand | META domain |
| 6 | PF03891.17 | 0.62 | 15 | 1777.5 | opposite-strand | Domain of unknown function (DUF333) |
| 7 | PF07027.14 | 0.96 | 23 | 2675.0 | opposite-strand | Protein of unknown function (DUF1318) |