ProsmORF-pred
Result : EXP00936
Protein Information
Information Type Description
Protein name EXP00936
NCBI Accession ID CP001509.3
Organism Escherichia coli BL21(DE3)
Left 1418600
Right 1418785
Strand -
Nucleotide Sequence ATGATTAAACCTTTACGCGTAATGCGTGGGCTTTCATCTAATGCAATACGTGTCCCGAGCGGTAGCCAGATGCCCGCCAGCGTGGGAACCCACAGCCCGAGCGTCATCAGCAGCGTCAACGGCACAAGAATAATCAGTAATAACAGCGCGAGAACGGCTTTATATTTACCCAGCATGGGTAGTTAA
Sequence MIKPLRVMRGLSSNAIRVPSGSQMPASVGTHSPSVISSVNGTRIISNNSARTALYLPSMGS
Source of smORF Ribo-seq
Function
Pubmed ID 30904393
Domain
Functional Category Function not yet assigned
Uniprot ID
ORF Length (Amino Acid) 61
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 24
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 2258034 2258219 + NZ_CP061527.1 Shigella dysenteriae
2 1443041 1443226 - NC_000913.3 Escherichia coli str. K-12 substr. MG1655
3 1980680 1980865 - NC_002695.2 Escherichia coli O157:H7 str. Sakai
4 1852425 1852610 - NC_004337.2 Shigella flexneri 2a str. 301
5 2286664 2286828 + NZ_LR134340.1 Escherichia marmotae
6 1463883 1464068 - NZ_AP014857.1 Escherichia albertii
7 3037177 3037344 - NZ_CP045205.1 Citrobacter telavivensis
8 3908651 3908818 + NZ_LT556085.1 Citrobacter amalonaticus
9 654153 654317 + NZ_CP057657.1 Escherichia fergusonii
10 2146964 2147137 - NZ_CP013990.1 Leclercia adecarboxylata
11 1035009 1035188 - NZ_CP023529.1 Lelliottia amnigena
12 2155614 2155781 - NZ_CP027986.1 Enterobacter sichuanensis
13 1327187 1327360 + NZ_CP045769.1 Enterobacter cancerogenus
14 2159257 2159418 - NZ_CP009756.1 Enterobacter cloacae
15 2821132 2821317 + NZ_CP041247.1 Raoultella electrica
16 2620946 2621131 + NZ_CP015113.1 Kosakonia radicincitans
17 2566375 2566560 - NZ_CP014007.2 Kosakonia oryzae
18 3273717 3273890 + NZ_CP036175.1 Klebsiella huaxiensis
19 2499544 2499696 + NZ_CP045845.1 Kluyvera intermedia
20 3226681 3226854 + NZ_CP050508.1 Raoultella terrigena
21 2329924 2330103 + NZ_AP023184.1 Buttiauxella agrestis
22 2417391 2417564 + NZ_CP054058.1 Scandinavium goeteborgense
23 4026539 4026703 + NZ_CP040428.1 Jejubacter calystegiae
24 2162803 2162973 - NZ_LR134201.1 Cedecea lapagei
25 2277713 2277880 - NZ_CP035129.1 Kosakonia cowanii
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_000913.3
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF13617.8 1.0 24 2476 opposite-strand YnbE-like lipoprotein
2 PF11739.10 1.0 24 -163 opposite-strand Dicarboxylate transport
3 PF02826.21 0.96 23 202.5 same-strand D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
4 PF00389.32 0.96 23 202.5 same-strand D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
5 PF03724.18 0.79 19 1488.5 same-strand META domain
6 PF03891.17 0.62 15 1777.5 opposite-strand Domain of unknown function (DUF333)
7 PF07027.14 0.96 23 2675.0 opposite-strand Protein of unknown function (DUF1318)
++ More..