Result : B2G848
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
| NCBI Accession ID | AP007281.1 |
| Organism | Lactobacillus reuteri (strain JCM 1112) |
| Left | 1275510 |
| Right | 1275791 |
| Strand | - |
| Nucleotide Sequence | ATGGCAACAGCAAAACCAACATTTGAAGAACAATTAGCACAATTACAACAGATCGTTAATCACCTTGAACAGGGGAATGTGCCACTAGAAGAAGCCCTTCAACAGTTTCAAGAAGGAATCAAGCTTTCTAAAGAATTACAAACGAAGCTAACAAATGCTGAAAAAACGCTTGGTCACTTAATTGACGATAATGGCGATGAAAAAGTCTACGAAAAGCAAACCGATGACCCAAGCAACAATGGCGGTGGTAACCGTGGATTTGGTAGCGCTGATGAACAATAA |
| Sequence | MATAKPTFEEQLAQLQQIVNHLEQGNVPLEEALQQFQEGIKLSKELQTKLTNAEKTLGHLIDDNGDEKVYEKQTDDPSNNGGGNRGFGSADEQ |
| Source of smORF | Swiss-Prot |
| Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
| Pubmed ID | 18487258 |
| Domain | CDD:412547 |
| Functional Category | Others |
| Uniprot ID | B2G848 |
| ORF Length (Amino Acid) | 93 |
++ More..
| Conservation Analysis |
No. of Species: 17
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1274796 | 1275077 | - | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 2 | 1104174 | 1104464 | - | NZ_CP045530.1 | Limosilactobacillus pontis |
| 3 | 1054698 | 1054994 | - | NZ_CP044534.1 | Limosilactobacillus frumenti |
| 4 | 1165720 | 1166010 | - | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 5 | 712449 | 712694 | + | NZ_CP059276.1 | Lactobacillus taiwanensis |
| 6 | 731344 | 731589 | + | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
| 7 | 725140 | 725385 | + | NZ_AP018549.1 | Lactobacillus paragasseri |
| 8 | 2015836 | 2016090 | - | NZ_CP042371.1 | Secundilactobacillus malefermentans |
| 9 | 1806559 | 1806807 | + | NZ_CP018906.1 | Lentilactobacillus curieae |
| 10 | 508056 | 508298 | + | NZ_CP031835.1 | Lactobacillus amylolyticus |
| 11 | 1258165 | 1258419 | + | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 12 | 1091339 | 1091581 | - | NZ_CP015444.1 | Lactobacillus helveticus |
| 13 | 572759 | 572986 | + | NZ_CP011403.1 | Ligilactobacillus salivarius str. Ren |
| 14 | 1411093 | 1411326 | - | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 15 | 2916900 | 2917157 | - | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 16 | 704609 | 704842 | + | NZ_CP032626.1 | Apilactobacillus bombintestini |
| 17 | 825445 | 825681 | + | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP042371.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02463.21 | 1.0 | 17 | 2187 | same-strand | RecF/RecN/SMC N terminal domain |
| 2 | PF13476.8 | 0.82 | 14 | 2179.0 | same-strand | AAA domain |
| 3 | PF01316.23 | 0.65 | 11 | 1727 | same-strand | Arginine repressor, DNA binding domain |
| 4 | PF02863.20 | 0.65 | 11 | 1727 | same-strand | Arginine repressor, C-terminal domain |
| 5 | PF01728.21 | 1.0 | 17 | 889 | same-strand | FtsJ-like methyltransferase |
| 6 | PF00348.19 | 1.0 | 17 | 1 | same-strand | Polyprenyl synthetase |
| 7 | PF02601.17 | 1.0 | 17 | 0 | same-strand | Exonuclease VII, large subunit |
| 8 | PF13742.8 | 1.0 | 17 | 0 | same-strand | OB-fold nucleic acid binding domain |
| 9 | PF01336.27 | 1.0 | 17 | 0 | same-strand | OB-fold nucleic acid binding domain |
| 10 | PF02882.21 | 1.0 | 17 | 1341.0 | same-strand | Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain |
| 11 | PF00763.25 | 1.0 | 17 | 1341.0 | same-strand | Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain |
| 12 | PF01029.20 | 1.0 | 17 | 2321 | same-strand | NusB family |
| 13 | PF03780.15 | 0.94 | 16 | 2726.0 | same-strand | Asp23 family, cell envelope-related function |
| 14 | PF08207.14 | 0.71 | 12 | 3168.5 | same-strand | Elongation factor P (EF-P) KOW-like domain |
| 15 | PF09285.13 | 0.71 | 12 | 3168.5 | same-strand | Elongation factor P, C-terminal |
| 16 | PF01132.22 | 0.71 | 12 | 3168.5 | same-strand | Elongation factor P (EF-P) OB domain |
++ More..