Protein Information |
Information Type | Description |
---|---|
Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
NCBI Accession ID | AP007281.1 |
Organism | Lactobacillus reuteri (strain JCM 1112) |
Left | 1275510 |
Right | 1275791 |
Strand | - |
Nucleotide Sequence | ATGGCAACAGCAAAACCAACATTTGAAGAACAATTAGCACAATTACAACAGATCGTTAATCACCTTGAACAGGGGAATGTGCCACTAGAAGAAGCCCTTCAACAGTTTCAAGAAGGAATCAAGCTTTCTAAAGAATTACAAACGAAGCTAACAAATGCTGAAAAAACGCTTGGTCACTTAATTGACGATAATGGCGATGAAAAAGTCTACGAAAAGCAAACCGATGACCCAAGCAACAATGGCGGTGGTAACCGTGGATTTGGTAGCGCTGATGAACAATAA |
Sequence | MATAKPTFEEQLAQLQQIVNHLEQGNVPLEEALQQFQEGIKLSKELQTKLTNAEKTLGHLIDDNGDEKVYEKQTDDPSNNGGGNRGFGSADEQ |
Source of smORF | Swiss-Prot |
Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
Pubmed ID | 18487258 |
Domain | CDD:412547 |
Functional Category | Others |
Uniprot ID | B2G848 |
ORF Length (Amino Acid) | 93 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1274796 | 1275077 | - | NZ_CP045605.1 | Limosilactobacillus reuteri |
2 | 1104174 | 1104464 | - | NZ_CP045530.1 | Limosilactobacillus pontis |
3 | 1054698 | 1054994 | - | NZ_CP044534.1 | Limosilactobacillus frumenti |
4 | 1165720 | 1166010 | - | NZ_CP045240.1 | Limosilactobacillus vaginalis |
5 | 712449 | 712694 | + | NZ_CP059276.1 | Lactobacillus taiwanensis |
6 | 731344 | 731589 | + | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
7 | 725140 | 725385 | + | NZ_AP018549.1 | Lactobacillus paragasseri |
8 | 2015836 | 2016090 | - | NZ_CP042371.1 | Secundilactobacillus malefermentans |
9 | 1806559 | 1806807 | + | NZ_CP018906.1 | Lentilactobacillus curieae |
10 | 508056 | 508298 | + | NZ_CP031835.1 | Lactobacillus amylolyticus |
11 | 1258165 | 1258419 | + | NZ_CP040586.1 | Furfurilactobacillus rossiae |
12 | 1091339 | 1091581 | - | NZ_CP015444.1 | Lactobacillus helveticus |
13 | 572759 | 572986 | + | NZ_CP011403.1 | Ligilactobacillus salivarius str. Ren |
14 | 1411093 | 1411326 | - | NZ_CP018180.1 | Liquorilactobacillus nagelii |
15 | 2916900 | 2917157 | - | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
16 | 704609 | 704842 | + | NZ_CP032626.1 | Apilactobacillus bombintestini |
17 | 825445 | 825681 | + | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02463.21 | 1.0 | 17 | 2187 | same-strand | RecF/RecN/SMC N terminal domain |
2 | PF13476.8 | 0.82 | 14 | 2179.0 | same-strand | AAA domain |
3 | PF01316.23 | 0.65 | 11 | 1727 | same-strand | Arginine repressor, DNA binding domain |
4 | PF02863.20 | 0.65 | 11 | 1727 | same-strand | Arginine repressor, C-terminal domain |
5 | PF01728.21 | 1.0 | 17 | 889 | same-strand | FtsJ-like methyltransferase |
6 | PF00348.19 | 1.0 | 17 | 1 | same-strand | Polyprenyl synthetase |
7 | PF02601.17 | 1.0 | 17 | 0 | same-strand | Exonuclease VII, large subunit |
8 | PF13742.8 | 1.0 | 17 | 0 | same-strand | OB-fold nucleic acid binding domain |
9 | PF01336.27 | 1.0 | 17 | 0 | same-strand | OB-fold nucleic acid binding domain |
10 | PF02882.21 | 1.0 | 17 | 1341.0 | same-strand | Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain |
11 | PF00763.25 | 1.0 | 17 | 1341.0 | same-strand | Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain |
12 | PF01029.20 | 1.0 | 17 | 2321 | same-strand | NusB family |
13 | PF03780.15 | 0.94 | 16 | 2726.0 | same-strand | Asp23 family, cell envelope-related function |
14 | PF08207.14 | 0.71 | 12 | 3168.5 | same-strand | Elongation factor P (EF-P) KOW-like domain |
15 | PF09285.13 | 0.71 | 12 | 3168.5 | same-strand | Elongation factor P, C-terminal |
16 | PF01132.22 | 0.71 | 12 | 3168.5 | same-strand | Elongation factor P (EF-P) OB domain |