Result : EXP00925

Protein Information

• Protein name: EXP00925
• NCBI Accession ID: CP001509.3
• Organism: Escherichia coli BL21(DE3)
• Left: 3558680
• Right: 3558784
• Strand: -
• Nucleotide Sequence: ATCATGTTGTTGACGGCATTACAGAACACATCCCACTTCTGGAAACCACGCAGTTTGAGCGGCTGGGTCATTGACAGCAAGGTAGTGATATCTTCCGGCACATAG
• Sequence: IMLLTALQNTSHFWKPRSLSGWVIDSKVVISSGT
• Source of smORF: Ribo-seq
• Pubmed ID: 30904393
• Functional Category: Function not yet assigned
• ORF Length (Amino Acid): 34

Conservation Analysis

No. of Species: 9

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	3667105	3667200	-	NC_004337.2	Shigella flexneri 2a str. 301
2	4439763	4439858	-	NC_002695.2	Escherichia coli O157:H7 str. Sakai
3	3697492	3697587	-	NC_000913.3	Escherichia coli str. K-12 substr. MG1655
4	3709747	3709842	+	NZ_CP061527.1	Shigella dysenteriae
5	1434615	1434716	+	NZ_LT556085.1	Citrobacter amalonaticus
6	207596	207709	+	NZ_CP035129.1	Kosakonia cowanii
7	4574425	4574526	-	NC_009792.1	Citrobacter koseri ATCC BAA-895
8	4468848	4468961	-	NZ_CP027986.1	Enterobacter sichuanensis
9	3068965	3069063	-	NZ_CP017279.1	Enterobacter ludwigii
10	2847537	2847656	+	NZ_CP025034.2	Enterobacter sp. SGAir0187

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_LT556085.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF00535.28	0.89	8	2256	same-strand	Glycosyl transferase family 2
2	PF13641.8	0.89	8	2256	same-strand	Glycosyltransferase like family 2
3	PF13506.8	0.89	8	2256	same-strand	Glycosyl transferase family 21
4	PF06564.14	0.89	8	1453.5	same-strand	Cellulose biosynthesis protein BcsQ
5	PF13614.8	0.78	7	1396	same-strand	AAA domain
6	PF01656.25	0.89	8	1453.5	same-strand	CobQ/CobB/MinD/ParA nucleotide binding domain
7	PF10995.10	0.89	8	-101	opposite-strand	Cellulose biosynthesis GIL
8	PF11120.10	0.89	8	439	opposite-strand	Cellulose biosynthesis protein BcsF
9	PF11658.10	0.89	8	626	opposite-strand	Cellulose biosynthesis protein BcsG
10	PF13632.8	0.78	7	2200.5	same-strand	Glycosyl transferase family group 2
11	PF07238.16	0.78	7	2200.5	same-strand	PilZ domain
12	PF10945.10	0.78	7	1251.5	same-strand	Cellulose biosynthesis protein BcsR
13	PF03170.15	0.78	7	4807	same-strand	Bacterial cellulose synthase subunit