Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00917 |
NCBI Accession ID | CP001509.3 |
Organism | Escherichia coli BL21(DE3) |
Left | 3396832 |
Right | 3397023 |
Strand | - |
Nucleotide Sequence | GTGAGCTTTTTTAAGAATACACGCTTACAAATTGTTGCGAACCTTTGGGAGTACAAACAATGCAAGAGAACTACAATATTCTGGTGGTCGATGACGACATGCGCCTGCGTGCGCTGCTGGAACGTTATCTCACCGAACAAGGCTTCCAGGTTCGAAGCGTCGCTAATGCAGAACAGATGGATCGCCTGCTGA |
Sequence | VSFFKNTRLQIVANLWEYKQCKRTTIFWWSMTTCACVRCWNVISPNKASRFEASLMQNRWIAC |
Source of smORF | Ribo-seq |
Function | |
Pubmed ID | 30904393 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 63 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3505738 | 3505929 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
2 | 3536452 | 3536643 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
3 | 3492977 | 3493177 | - | NZ_AP014857.1 | Escherichia albertii |
4 | 4248774 | 4248965 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
5 | 2438634 | 2438834 | - | NZ_CP057657.1 | Escherichia fergusonii |
6 | 194334 | 194525 | - | NZ_CP061527.1 | Shigella dysenteriae |
7 | 4514467 | 4514661 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
8 | 2762143 | 2762337 | - | NZ_CP016337.1 | Kosakonia sacchari |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01293.22 | 0.71 | 5 | 2012.0 | opposite-strand | Phosphoenolpyruvate carboxykinase |
2 | PF02518.28 | 1.0 | 7 | 584.0 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
3 | PF00512.27 | 1.0 | 7 | 584.0 | same-strand | His Kinase A (phospho-acceptor) domain |
4 | PF00672.27 | 1.0 | 7 | 584.0 | same-strand | HAMP domain |
5 | PF00072.26 | 1.0 | 7 | -132.0 | same-strand | Response regulator receiver domain |
6 | PF00486.30 | 1.0 | 7 | -132.0 | same-strand | Transcriptional regulatory protein, C terminal |
7 | PF03449.17 | 1.0 | 7 | 167.5 | opposite-strand | Transcription elongation factor, N-terminal |
8 | PF01272.21 | 1.0 | 7 | 167.5 | opposite-strand | Transcription elongation factor, GreA/GreB, C-term |
9 | PF09371.12 | 1.0 | 7 | 738.5 | opposite-strand | Tex-like protein N-terminal domain |
10 | PF16921.7 | 1.0 | 7 | 738.5 | opposite-strand | Tex protein YqgF-like domain |
11 | PF12836.9 | 1.0 | 7 | 738.5 | opposite-strand | Helix-hairpin-helix motif |
12 | PF00575.25 | 1.0 | 7 | 738.5 | opposite-strand | S1 RNA binding domain |
13 | PF17674.3 | 1.0 | 7 | 738.5 | opposite-strand | HHH domain |
14 | PF14635.8 | 1.0 | 7 | 738.5 | opposite-strand | Helix-hairpin-helix motif |
15 | PF14639.8 | 0.71 | 5 | 738.5 | opposite-strand | Holliday-junction resolvase-like of SPT6 |
16 | PF04023.16 | 0.71 | 5 | 3510.5 | opposite-strand | FeoA domain |
17 | PF02421.20 | 1.0 | 7 | 3764.0 | opposite-strand | Ferrous iron transport protein B |
18 | PF07670.16 | 1.0 | 7 | 3764.0 | opposite-strand | Nucleoside recognition |
19 | PF07664.14 | 1.0 | 7 | 3764.0 | opposite-strand | Ferrous iron transport protein B C terminus |
20 | PF01926.25 | 1.0 | 7 | 3764.0 | opposite-strand | 50S ribosome-binding GTPase |
21 | PF17910.3 | 1.0 | 7 | 3764.0 | opposite-strand | FeoB cytosolic helical domain |
22 | PF09012.12 | 1.0 | 7 | 6085.0 | opposite-strand | FeoC like transcriptional regulator |