ProsmORF-pred
Result : EXP00917
Protein Information
Information Type Description
Protein name EXP00917
NCBI Accession ID CP001509.3
Organism Escherichia coli BL21(DE3)
Left 3396832
Right 3397023
Strand -
Nucleotide Sequence GTGAGCTTTTTTAAGAATACACGCTTACAAATTGTTGCGAACCTTTGGGAGTACAAACAATGCAAGAGAACTACAATATTCTGGTGGTCGATGACGACATGCGCCTGCGTGCGCTGCTGGAACGTTATCTCACCGAACAAGGCTTCCAGGTTCGAAGCGTCGCTAATGCAGAACAGATGGATCGCCTGCTGA
Sequence VSFFKNTRLQIVANLWEYKQCKRTTIFWWSMTTCACVRCWNVISPNKASRFEASLMQNRWIAC
Source of smORF Ribo-seq
Function
Pubmed ID 30904393
Domain
Functional Category Function not yet assigned
Uniprot ID
ORF Length (Amino Acid) 63
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 7
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 3505738 3505929 - NC_004337.2 Shigella flexneri 2a str. 301
2 3536452 3536643 - NC_000913.3 Escherichia coli str. K-12 substr. MG1655
3 3492977 3493177 - NZ_AP014857.1 Escherichia albertii
4 4248774 4248965 - NC_002695.2 Escherichia coli O157:H7 str. Sakai
5 2438634 2438834 - NZ_CP057657.1 Escherichia fergusonii
6 194334 194525 - NZ_CP061527.1 Shigella dysenteriae
7 4514467 4514661 - NZ_CP063425.1 Kosakonia pseudosacchari
8 2762143 2762337 - NZ_CP016337.1 Kosakonia sacchari
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_004337.2
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF01293.22 0.71 5 2012.0 opposite-strand Phosphoenolpyruvate carboxykinase
2 PF02518.28 1.0 7 584.0 same-strand Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
3 PF00512.27 1.0 7 584.0 same-strand His Kinase A (phospho-acceptor) domain
4 PF00672.27 1.0 7 584.0 same-strand HAMP domain
5 PF00072.26 1.0 7 -132.0 same-strand Response regulator receiver domain
6 PF00486.30 1.0 7 -132.0 same-strand Transcriptional regulatory protein, C terminal
7 PF03449.17 1.0 7 167.5 opposite-strand Transcription elongation factor, N-terminal
8 PF01272.21 1.0 7 167.5 opposite-strand Transcription elongation factor, GreA/GreB, C-term
9 PF09371.12 1.0 7 738.5 opposite-strand Tex-like protein N-terminal domain
10 PF16921.7 1.0 7 738.5 opposite-strand Tex protein YqgF-like domain
11 PF12836.9 1.0 7 738.5 opposite-strand Helix-hairpin-helix motif
12 PF00575.25 1.0 7 738.5 opposite-strand S1 RNA binding domain
13 PF17674.3 1.0 7 738.5 opposite-strand HHH domain
14 PF14635.8 1.0 7 738.5 opposite-strand Helix-hairpin-helix motif
15 PF14639.8 0.71 5 738.5 opposite-strand Holliday-junction resolvase-like of SPT6
16 PF04023.16 0.71 5 3510.5 opposite-strand FeoA domain
17 PF02421.20 1.0 7 3764.0 opposite-strand Ferrous iron transport protein B
18 PF07670.16 1.0 7 3764.0 opposite-strand Nucleoside recognition
19 PF07664.14 1.0 7 3764.0 opposite-strand Ferrous iron transport protein B C terminus
20 PF01926.25 1.0 7 3764.0 opposite-strand 50S ribosome-binding GTPase
21 PF17910.3 1.0 7 3764.0 opposite-strand FeoB cytosolic helical domain
22 PF09012.12 1.0 7 6085.0 opposite-strand FeoC like transcriptional regulator
++ More..