Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00915 |
NCBI Accession ID | CP001509.3 |
Organism | Escherichia coli BL21(DE3) |
Left | 3493049 |
Right | 3493162 |
Strand | - |
Nucleotide Sequence | ATGATGACAACATTACTACCCGTTTTCACTAAGCCTTCCCCGTTGGCGCTCAATGCTCTGCGCGCTGGTCGTATTTGCCGTTTCCTTCTTATCCCGGATGGAAGAATCCGCTGA |
Sequence | MMTTLLPVFTKPSPLALNALRAGRICRFLLIPDGRIR |
Source of smORF | Ribo-seq |
Function | INDUCTION: Expressed in exponential and stationary phase in rich medium; expression is a bit higher in stationary phase (at protein level) Pubmed:30837344 |
Pubmed ID | 30904393 |
Domain | |
Functional Category | Gene Ontology/Expression based functional assignment |
Uniprot ID | P0DSG8 |
ORF Length (Amino Acid) | 37 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 4365267 | 4365380 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
2 | 3630665 | 3630778 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
3 | 3595308 | 3595421 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
4 | 4121959 | 4122072 | - | NZ_LR134340.1 | Escherichia marmotae |
5 | 3593835 | 3593948 | - | NZ_AP014857.1 | Escherichia albertii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF12698.9 | 1.0 | 4 | 2494.5 | same-strand | ABC-2 family transporter protein |
2 | PF00005.29 | 1.0 | 4 | 1127.0 | same-strand | ABC transporter |
3 | PF13437.8 | 1.0 | 4 | 63 | same-strand | HlyD family secretion protein |
4 | PF16576.7 | 0.75 | 3 | 63.0 | same-strand | Barrel-sandwich domain of CusB or HlyD membrane-fusion |
5 | PF13533.8 | 1.0 | 4 | 63 | same-strand | Biotin-lipoyl like |
6 | PF00529.22 | 1.0 | 4 | 63 | same-strand | Cation efflux system protein CusB domain 1 |
7 | PF10951.10 | 0.75 | 3 | 2310.5 | opposite-strand | Protein of unknown function (DUF2776) |
8 | PF03486.16 | 0.75 | 3 | 3569.5 | same-strand | HI0933-like protein |