Result : EXP00915
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00915 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 3493049 |
| Right | 3493162 |
| Strand | - |
| Nucleotide Sequence | ATGATGACAACATTACTACCCGTTTTCACTAAGCCTTCCCCGTTGGCGCTCAATGCTCTGCGCGCTGGTCGTATTTGCCGTTTCCTTCTTATCCCGGATGGAAGAATCCGCTGA |
| Sequence | MMTTLLPVFTKPSPLALNALRAGRICRFLLIPDGRIR |
| Source of smORF | Ribo-seq |
| Function | INDUCTION: Expressed in exponential and stationary phase in rich medium; expression is a bit higher in stationary phase (at protein level) Pubmed:30837344 |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Gene Ontology/Expression based functional assignment |
| Uniprot ID | P0DSG8 |
| ORF Length (Amino Acid) | 37 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4365267 | 4365380 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 3630665 | 3630778 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 3595308 | 3595421 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 4121959 | 4122072 | - | NZ_LR134340.1 | Escherichia marmotae |
| 5 | 3593835 | 3593948 | - | NZ_AP014857.1 | Escherichia albertii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12698.9 | 1.0 | 4 | 2494.5 | same-strand | ABC-2 family transporter protein |
| 2 | PF00005.29 | 1.0 | 4 | 1127.0 | same-strand | ABC transporter |
| 3 | PF13437.8 | 1.0 | 4 | 63 | same-strand | HlyD family secretion protein |
| 4 | PF16576.7 | 0.75 | 3 | 63.0 | same-strand | Barrel-sandwich domain of CusB or HlyD membrane-fusion |
| 5 | PF13533.8 | 1.0 | 4 | 63 | same-strand | Biotin-lipoyl like |
| 6 | PF00529.22 | 1.0 | 4 | 63 | same-strand | Cation efflux system protein CusB domain 1 |
| 7 | PF10951.10 | 0.75 | 3 | 2310.5 | opposite-strand | Protein of unknown function (DUF2776) |
| 8 | PF03486.16 | 0.75 | 3 | 3569.5 | same-strand | HI0933-like protein |
++ More..