Result : EXP00912
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00912 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 2239636 |
| Right | 2239737 |
| Strand | - |
| Nucleotide Sequence | ATGTGTCGAGCGCAACGGCAAAAAGCTGTATGTAAAGCGCATGACGCATCATCTGTTTCATTCCGTACGTTATCCGTTCGGCCGACCAACGATTGTCCGTGA |
| Sequence | MCRAQRQKAVCKAHDASSVSFRTLSVRPTNDCP |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 33 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2349267 | 2349368 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 3075178 | 3075279 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 1371886 | 1371987 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 2366020 | 2366121 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12951.9 | 0.67 | 2 | 5146 | same-strand | Passenger-associated-transport-repeat |
| 2 | PF02867.17 | 1.0 | 3 | 2113.5 | opposite-strand | Ribonucleotide reductase, barrel domain |
| 3 | PF03477.18 | 1.0 | 3 | 2113.5 | opposite-strand | ATP cone domain |
| 4 | PF00317.23 | 1.0 | 3 | 2113.5 | opposite-strand | Ribonucleotide reductase, all-alpha domain |
| 5 | PF00268.23 | 1.0 | 3 | 753.0 | opposite-strand | Ribonucleotide reductase, small chain |
| 6 | PF00111.29 | 1.0 | 3 | 499.0 | opposite-strand | 2Fe-2S iron-sulfur cluster binding domain |
| 7 | PF06293.16 | 1.0 | 3 | -101.0 | same-strand | Lipopolysaccharide kinase (Kdo/WaaP) family |
| 8 | PF03009.19 | 1.0 | 3 | 1511.5 | same-strand | Glycerophosphoryl diester phosphodiesterase family |
| 9 | PF07690.18 | 1.0 | 3 | 916.5 | same-strand | Major Facilitator Superfamily |
| 10 | PF01266.26 | 0.67 | 2 | 3279.0 | opposite-strand | FAD dependent oxidoreductase |
| 11 | PF04324.17 | 0.67 | 2 | 3279.0 | opposite-strand | BFD-like [2Fe-2S] binding domain |
| 12 | PF16901.7 | 0.67 | 2 | 3279.0 | opposite-strand | C-terminal domain of alpha-glycerophosphate oxidase |
| 13 | PF00890.26 | 0.67 | 2 | 4897.0 | opposite-strand | FAD binding domain |
| 14 | PF03466.22 | 0.67 | 2 | 1642.5 | opposite-strand | LysR substrate binding domain |
++ More..