| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
| NCBI Accession ID | CP001034.1 |
| Organism | Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) |
| Left | 490370 |
| Right | 490657 |
| Strand | + |
| Nucleotide Sequence | ATGAAGGTTAGTAAAGAAGAGGTCCTTCACGTGGCCAAGCTAGGACAATTGGATCTTGACCAAGAGGAAGTCGAAATGTTTCAGGATAAGTTATCTCAAATTTTGGAGTGGCAGGAAAAACTTGATGAGCTGGATTTAGAAGGATTGGAACCAACGGCTCATGCTCTGGAAAGAAGAAATGTTACCAGAGAAGATCAAGTCCATAATTCATTAACCAATGATAAAGCTTTGGAAAATGCTCCTGAAACAGAAGGCAATTATTTTAAAGTTCCAAGAATAATTGAATAA |
| Sequence | MKVSKEEVLHVAKLGQLDLDQEEVEMFQDKLSQILEWQEKLDELDLEGLEPTAHALERRNVTREDQVHNSLTNDKALENAPETEGNYFKVPRIIE |
| Source of smORF | Swiss-Prot |
| Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
| Pubmed ID | |
| Domain | CDD:412411 |
| Functional Category | Others |
| Uniprot ID | B2A5W6 |
| ORF Length (Amino Acid) | 95 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 490370 | 490657 | + | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 2 | 684710 | 684997 | + | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 3 | 642064 | 642351 | + | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 4 | 1721936 | 1722223 | - | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 5 | 584357 | 584644 | + | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 6 | 719434 | 719721 | + | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 7 | 976711 | 976995 | + | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 8 | 1613311 | 1613601 | - | NC_014926.1 | Thermovibrio ammonificans HB-1 |
| 9 | 5465455 | 5465742 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 10 | 2507880 | 2508188 | + | NZ_CP019791.1 | Anaerohalosphaera lusitana |
| 11 | 609738 | 610025 | + | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 12 | 774524 | 774760 | + | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 13 | 4199797 | 4200084 | + | NZ_CP016809.1 | Paenibacillus ihbetae |
| 14 | 389836 | 390126 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 15 | 880952 | 881239 | + | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
| 16 | 2153510 | 2153806 | - | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 17 | 2507300 | 2507530 | + | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 18 | 74027 | 74317 | - | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13361.8 | 0.61 | 11 | 2084 | same-strand | UvrD-like helicase C-terminal domain |
| 2 | PF00580.23 | 0.61 | 11 | 2084 | same-strand | UvrD/REP helicase N-terminal domain |
| 3 | PF13245.8 | 0.61 | 11 | 2084 | same-strand | AAA domain |
| 4 | PF13538.8 | 0.61 | 11 | 2084 | same-strand | UvrD-like helicase C-terminal domain |
| 5 | PF01653.20 | 0.61 | 11 | 78 | same-strand | NAD-dependent DNA ligase adenylation domain |
| 6 | PF03120.18 | 0.61 | 11 | 78 | same-strand | NAD-dependent DNA ligase OB-fold domain |
| 7 | PF12826.9 | 0.61 | 11 | 78 | same-strand | Helix-hairpin-helix motif |
| 8 | PF14520.8 | 0.61 | 11 | 78 | same-strand | Helix-hairpin-helix domain |
| 9 | PF00533.28 | 0.61 | 11 | 78 | same-strand | BRCA1 C Terminus (BRCT) domain |
| 10 | PF03119.18 | 0.61 | 11 | 78 | same-strand | NAD-dependent DNA ligase C4 zinc finger domain |
| 11 | PF01425.23 | 1.0 | 18 | 19.5 | same-strand | Amidase |
| 12 | PF02934.17 | 0.89 | 16 | 1500.5 | same-strand | GatB/GatE catalytic domain |
| 13 | PF02637.20 | 0.89 | 16 | 1500.5 | same-strand | GatB domain |