Result : EXP00907
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00907 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 4342876 |
| Right | 4343055 |
| Strand | - |
| Nucleotide Sequence | GTGATAACGCGAAACAGCTCACAAAAATACACGCTTACGGGGTCTTTGCAACACAAAATAGCGCCGTTTGGCAAACTGAAGGGTTTATTGCTGAATGCCTGCTCCCCTCTGGTTCGAGGGGAACAGAATGCGCTGCTTAGAGGATTTCCAGCAGTTCGACTTCAAACACCAGGGTGCTGA |
| Sequence | VITRNSSQKYTLTGSLQHKIAPFGKLKGLLLNACSPLVRGEQNALLRGFPAVRLQTPGC |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 59 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4429512 | 4429691 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 5285113 | 5285292 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 3887136 | 3887315 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 462451 | 462630 | - | NZ_LR134340.1 | Escherichia marmotae |
| 5 | 4458274 | 4458465 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04225.14 | 1.0 | 4 | 795 | same-strand | Opacity-associated protein A LysM-like domain |
| 2 | PF08525.13 | 1.0 | 4 | 795 | same-strand | Opacity-associated protein A N-terminal motif |
| 3 | PF00254.30 | 1.0 | 4 | -43 | opposite-strand | FKBP-type peptidyl-prolyl cis-trans isomerase |
| 4 | PF01346.20 | 1.0 | 4 | -43 | opposite-strand | Domain amino terminal to FKBP-type peptidyl-prolyl isomerase |
| 5 | PF00324.23 | 1.0 | 4 | 173 | opposite-strand | Amino acid permease |
| 6 | PF13520.8 | 1.0 | 4 | 173 | opposite-strand | Amino acid permease |
| 7 | PF01814.25 | 1.0 | 4 | 1630 | same-strand | Hemerythrin HHE cation binding domain |
| 8 | PF04405.16 | 1.0 | 4 | 1630 | same-strand | Domain of Unknown function (DUF542) |
| 9 | PF00892.22 | 1.0 | 4 | 2400 | same-strand | EamA-like transporter family |
| 10 | PF05368.15 | 0.75 | 3 | 3470.5 | same-strand | NmrA-like family |
| 11 | PF13460.8 | 0.75 | 3 | 3470.5 | same-strand | NAD(P)H-binding |
| 12 | PF01638.19 | 0.75 | 3 | 4419.5 | opposite-strand | HxlR-like helix-turn-helix |
++ More..