Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00898 |
NCBI Accession ID | CP001509.3 |
Organism | Escherichia coli BL21(DE3) |
Left | 3576850 |
Right | 3576990 |
Strand | - |
Nucleotide Sequence | AGGGCGGTTATGCACGTTTTACGGAAGGAAAAAGTGAGCTGCAATGGCTGGAAACGTTTTATAACGTTGCCCGACAGCGCGGGGCAAGCCAGCAGGTTGAATTGCCGCCATTTGCTGAGTTCTGGCAAGCCAATCAGTTAA |
Sequence | RAVMHVLRKEKVSCNGWKRFITLPDSAGQASRLNCRHLLSSGKPIS |
Source of smORF | Ribo-seq |
Function | |
Pubmed ID | 30904393 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 46 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3906522 | 3906653 | - | NZ_CP061527.1 | Shigella dysenteriae |
2 | 3714696 | 3714827 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
3 | 4462395 | 4462526 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
4 | 3685759 | 3685890 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
5 | 3685574 | 3685705 | - | NZ_AP014857.1 | Escherichia albertii |
6 | 2630972 | 2631103 | - | NZ_CP057657.1 | Escherichia fergusonii |
7 | 4210918 | 4211049 | - | NZ_LR134340.1 | Escherichia marmotae |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03352.15 | 1.0 | 6 | 1041 | opposite-strand | Methyladenine glycosylase |
2 | PF00384.24 | 1.0 | 6 | -131 | same-strand | Molybdopterin oxidoreductase |
3 | PF01568.23 | 1.0 | 6 | -131 | same-strand | Molydopterin dinucleotide binding domain |
4 | PF00691.22 | 1.0 | 6 | 1720 | opposite-strand | OmpA family |
5 | PF02826.21 | 0.83 | 5 | 2483.0 | opposite-strand | D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain |
6 | PF00389.32 | 0.83 | 5 | 2483.0 | opposite-strand | D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain |
7 | PF11254.10 | 0.83 | 5 | 3507.0 | same-strand | Protein of unknown function (DUF3053) |
8 | PF00313.24 | 0.83 | 5 | 5221.5 | opposite-strand | 'Cold-shock' DNA-binding domain |
9 | PF00583.27 | 0.83 | 5 | 604 | opposite-strand | Acetyltransferase (GNAT) family |
10 | PF13508.9 | 0.83 | 5 | 604.0 | opposite-strand | Acetyltransferase (GNAT) domain |
11 | PF18364.3 | 0.83 | 5 | -131.0 | same-strand | Molybdopterin oxidoreductase N-terminal domain |
12 | PF13488.8 | 0.83 | 5 | 1720.0 | opposite-strand | Glycine zipper |
13 | PF13441.8 | 0.83 | 5 | 1720.0 | opposite-strand | YMGG-like Gly-zipper |
14 | PF05433.17 | 0.83 | 5 | 1720.0 | opposite-strand | Glycine zipper 2TM domain |