Result : EXP00881
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00881 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 617370 |
| Right | 617537 |
| Strand | - |
| Nucleotide Sequence | ATGTTACTTATTTTAGCTATTGATTTTAAAGAAGTTACTAAAACTTCATTTGTCTCAAAACTGAAAGCGCATCCAGGCAAAGTACACATTGCCATTGTTGTAGGTACCCGGAATGTAGGTCATCTGAAAAGTCACTGGGCCATAACCCACGGAGGCCAATGGCAGTAG |
| Sequence | MLLILAIDFKEVTKTSFVSKLKAHPGKVHIAIVVGTRNVGHLKSHWAITHGGQWQ |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 55 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 657004 | 657171 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 693351 | 693518 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 3084673 | 3084840 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 738360 | 738527 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_004337.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12431.10 | 0.67 | 2 | 2462 | opposite-strand | Transcriptional regulator |
| 2 | PF03606.17 | 0.67 | 2 | 1036 | same-strand | C4-dicarboxylate anaerobic carrier |
| 3 | PF07017.13 | 0.67 | 2 | -113 | opposite-strand | Antimicrobial peptide resistance and lipid A acylation protein PagP |
| 4 | PF00313.24 | 1.0 | 3 | 121.0 | opposite-strand | 'Cold-shock' DNA-binding domain |
| 5 | PF02537.17 | 1.0 | 3 | 384.0 | same-strand | CrcB-like protein, Camphor Resistance (CrcB) |
| 6 | PF02416.18 | 1.0 | 3 | 1777.0 | opposite-strand | mttA/Hcf106 family |
| 7 | PF04055.23 | 1.0 | 3 | 2081 | same-strand | Radical SAM superfamily |
| 8 | PF00795.24 | 1.0 | 3 | 860 | opposite-strand | Carbon-nitrogen hydrolase |
++ More..