Result : EXP00878

Protein Information

• Protein name: EXP00878
• NCBI Accession ID: CP001509.3
• Organism: Escherichia coli BL21(DE3)
• Left: 4451158
• Right: 4451283
• Strand: -
• Nucleotide Sequence: ATGAATACCTATAGGAAACCTCAATCGGTCAAAATTAGCCCAATAGATAAAAAGATAACCACACACGGAGTGATGTGGCTATCAGTCAATTACATTAAATATCATACAAAAATAAAATATCACTGA
• Sequence: MNTYRKPQSVKISPIDKKITTHGVMWLSVNYIKYHTKIKYH
• Source of smORF: Ribo-seq
• Pubmed ID: 30904393
• Functional Category: Function not yet assigned
• ORF Length (Amino Acid): 41

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	4541879	4542004	-	NC_000913.3	Escherichia coli str. K-12 substr. MG1655
2	5396914	5397039	-	NC_002695.2	Escherichia coli O157:H7 str. Sakai
3	4383213	4383338	+	NC_004337.2	Shigella flexneri 2a str. 301

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_000913.3

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF13964.8	1.0	2	3114	same-strand	Kelch motif
2	PF13418.8	1.0	2	3114	same-strand	Galactose oxidase, central domain
3	PF07646.17	1.0	2	3114	same-strand	Kelch motif
4	PF01344.27	1.0	2	3114	same-strand	Kelch motif
5	PF13854.8	1.0	2	3114	same-strand	Kelch motif
6	PF06178.15	1.0	2	2378	same-strand	Oligogalacturonate-specific porin protein (KdgM)
7	PF00589.24	1.0	2	176.5	opposite-strand	Phage integrase family
8	PF00419.22	1.0	2	1430.0	opposite-strand	Fimbrial protein
9	PF00345.22	1.0	2	2299	opposite-strand	Pili and flagellar-assembly chaperone, PapD N-terminal domain
10	PF02753.19	1.0	2	2299	opposite-strand	Pili assembly chaperone PapD, C-terminal domain
11	PF13954.8	1.0	2	3091	opposite-strand	PapC N-terminal domain