Result : B2A203
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatA |
| NCBI Accession ID | CP001034.1 |
| Organism | Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) |
| Left | 1299517 |
| Right | 1299753 |
| Strand | + |
| Nucleotide Sequence | ATGTTTGGTAGAATTGGGCTTCCTGAAATTTTGTTGATTCTGGCTATTGCATTAATTATTTTTGGACCTAAAAAATTACCTGAACTAGGGAAAGCTTTGGGCAGTAGTTTGAGAGAGTTTAAGAGTGCCACTAAGGAATTAAGAGAAGAAGTTAACGAAGTAGAAGAGGAAGTTAAAGAAAATAAATCAAGTGATGTAAAAGAAAACGAAGATAACAAAACTGAAAAATCAACCTAA |
| Sequence | MFGRIGLPEILLILAIALIIFGPKKLPELGKALGSSLREFKSATKELREEVNEVEEEVKENKSSDVKENEDNKTEKST |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | |
| Domain | |
| Functional Category | Others |
| Uniprot ID | B2A203 |
| ORF Length (Amino Acid) | 78 |
++ More..
| Conservation Analysis |
No. of Species: 34
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1299517 | 1299753 | + | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 2 | 893581 | 893790 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 3 | 1038804 | 1039013 | + | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 4 | 4847050 | 4847256 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 5 | 2267342 | 2267548 | + | NZ_CP034437.1 | Paenibacillus albus |
| 6 | 1340837 | 1341031 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 7 | 1542913 | 1543110 | - | NC_019386.1 | Thermus oshimai JL-2 |
| 8 | 314698 | 314910 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 9 | 1383175 | 1383381 | + | NZ_LT906446.1 | Megamonas hypermegale |
| 10 | 3120699 | 3120899 | + | NZ_CP022315.1 | Virgibacillus phasianinus |
| 11 | 257252 | 257464 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 12 | 2356867 | 2357073 | + | NZ_CP022437.1 | Virgibacillus necropolis |
| 13 | 277674 | 277886 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 14 | 1732601 | 1732813 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 15 | 1000882 | 1001088 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 16 | 3765887 | 3766084 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 17 | 312156 | 312368 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 18 | 5553691 | 5553897 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 19 | 517898 | 518122 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 20 | 418369 | 418581 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 21 | 269799 | 270011 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 22 | 284878 | 285090 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 23 | 247097 | 247309 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 24 | 285775 | 285987 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 25 | 1369187 | 1369390 | - | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 26 | 2054322 | 2054528 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 27 | 560429 | 560623 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
| 28 | 1888162 | 1888377 | + | NZ_CP021434.1 | Tumebacillus avium |
| 29 | 242051 | 242263 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 30 | 538977 | 539171 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 31 | 537922 | 538119 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 32 | 808040 | 808234 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 33 | 1145637 | 1145843 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 34 | 1863563 | 1863769 | - | NZ_CP010822.1 | Thermus aquaticus Y51MC23 |
| 35 | 367776 | 367985 | + | NC_006461.1 | Thermus thermophilus HB8 |
| 36 | 1263650 | 1263871 | - | NZ_CP017237.1 | Moorella thermoacetica |
| 37 | 4250928 | 4251125 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 38 | 112010 | 112210 | + | NC_015387.1 | Marinithermus hydrothermalis DSM 14884 |
| 39 | 1229891 | 1230097 | - | NZ_CP011058.1 | Paenibacillus beijingensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_010718.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00902.20 | 0.91 | 31 | 61 | same-strand | Sec-independent protein translocase protein (TatC) |
++ More..